DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a22 and Cyp4d2

DIOPT Version :9

Sequence 1:NP_001286431.1 Gene:Cyp6a22 / 49847 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001284806.1 Gene:Cyp4d2 / 31192 FlyBaseID:FBgn0011576 Length:501 Species:Drosophila melanogaster


Alignment Length:570 Identity:145/570 - (25%)
Similarity:226/570 - (39%) Gaps:156/570 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLDVV-ALLLIALA-VGFW-FVRTRYSYWTRRGIGSEPARFPVGNMEGFRKNKHFIDIVTPIYEK 62
            ||.|| .|||:|.| :..| |:      |.|||.|..|...|:                      
  Fly     1 MLGVVGVLLLVAFATLLLWDFL------WRRRGNGILPGPRPL---------------------- 37

  Fly    63 FKGNGAPFAGFFMMLRPVVLVTDLELAKQILIQDFANFEDRGMYHNERDDPLTGHLFRI------ 121
                  ||.|..:|.|.:    |.|     .|.||..       .|:|.   .|.|:|:      
  Fly    38 ------PFLGNLLMYRGL----DPE-----QIMDFVK-------KNQRK---YGRLYRVWILHQL 77

  Fly   122 ----------------------------------------DGPKWRPLRQKMSPTFTSAKMKYMF 146
                                                    .|.||...|:.::||| ..|:...|
  Fly    78 AVFSTDPRDIEFVLSSQQHITKNNLYKLLNCWLGDGLLMSTGRKWHGRRKIITPTF-HFKILEQF 141

  Fly   147 PTVCEVGEELTQVCGELADNAMCGI--LEIGDLMARYTSDVIGRCAFGVECNGLRNPEAEFAIMG 209
               .|:.::.:.|..|...:...|:  :.|..::.....|:|...|.|.:.|..:||...:.   
  Fly   142 ---VEIFDQQSAVMVEQLQSRADGMTPINIFPVICLTALDIIAETAMGTKINAQKNPNLPYV--- 200

  Fly   210 RRAFSERRHCKLVDGFIESFPEVARFLRMRQ----IHQD-----ITDFYVGIVR----------- 254
             :|.::..:. |:..||.::..|....|:.|    ..||     :.||...|:|           
  Fly   201 -QAVNDVTNI-LIKRFIHAWQRVDWIFRLTQPTEAKRQDKAIKVMHDFTENIIRERRETLVNNSK 263

  Fly   255 ETVKQREEQGIVRSDFMNLLIEMKQR----GELTIEEMAAQAFIFFAAGFDTSASTLGFALYELA 315
            ||..:.|...:.:...|.||..:.|.    ..|:.|::..:...|...|.||:.|.:.|.|||::
  Fly   264 ETTPEEEVNFLGQKRRMALLDVLLQSTIDGAPLSDEDIREEVDTFMFEGHDTTTSAISFCLYEIS 328

  Fly   316 KQPALQAKLREEIDQALRLHNGE-----FTYDSMQELRYMELVIAETLRKYPILPQLTRISRHLY 375
            :.|.:|.:|::||...|    ||     .|...:.||::||.||.|:||.:|.:|.:.|......
  Fly   329 RHPEVQQRLQQEIRDVL----GEDRKSPVTLRDLGELKFMENVIKESLRLHPPVPMIGRWFAEDV 389

  Fly   376 AAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEPHKFIPERFLADQLAQRPTAAWLPFGDGPRNCI 440
            ..:|.   :|..|....:.::.:..||..:..|.:|.||||.|| :.|....|::||..||||||
  Fly   390 EIRGK---HIPAGTNFTMGIFVLLRDPEYFESPDEFRPERFDAD-VPQIHPYAYIPFSAGPRNCI 450

  Fly   441 GMRFGKMQTTIGLVSLLRNFHFSVCP-RTDPKIEFLKSNILLCPANGIYL 489
            |.:|..::....:..|||  ||.:.| ..:|:...   ||:|..|||::|
  Fly   451 GQKFAMLEMKSTVSKLLR--HFELLPLGPEPRHSM---NIVLRSANGVHL 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 129/533 (24%)
Cyp4d2NP_001284806.1 p450 32..495 CDD:278495 128/531 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.