DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a22 and CYP4X1

DIOPT Version :9

Sequence 1:NP_001286431.1 Gene:Cyp6a22 / 49847 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_828847.1 Gene:CYP4X1 / 260293 HGNCID:20244 Length:509 Species:Homo sapiens


Alignment Length:528 Identity:136/528 - (25%)
Similarity:245/528 - (46%) Gaps:78/528 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LIALAVGFWFVRTRYSYWTRRGIGSEPARFPVGNMEGFRKNKHFI-----DIVTPIYEKFK---- 64
            :..||:|  .::....|..|:.:..:...||......|..::.||     :.:..|.||:.    
Human    19 VFCLALG--LLQAIKLYLRRQRLLRDLRPFPAPPTHWFLGHQKFIQDDNMEKLEEIIEKYPRAFP 81

  Fly    65 ---GNGAPFAGFFMMLRPVVLVTDLELAKQILIQDFANFEDRGMYHNERDDPLTGH-LFRIDGPK 125
               |   ||..||.:..|       :.||.:|    :..:.:..|..:...||.|. |..:||||
Human    82 FWIG---PFQAFFCIYDP-------DYAKTLL----SRTDPKSQYLQKFSPPLLGKGLAALDGPK 132

  Fly   126 WRPLRQKMSPTF----TSAKMKYMFPTVCEVGEELTQVCGELADNAMCGILEIGDLMARYTSDVI 186
            |...|:.::|.|    ..|.::.|..:|..:.::..::| ...|.:    :|:.:.:...:.|:|
Human   133 WFQHRRLLTPGFHFNILKAYIEVMAHSVKMMLDKWEKIC-STQDTS----VEVYEHINSMSLDII 192

  Fly   187 GRCAFGVE--C--NGLRNPEAE-----FAIMGRRAFSERRHCKLVDGFIESFPEVARFLRMRQIH 242
            .:|||..|  |  |...:|.|:     ..|:..|.:|...|..::   .:..|:..||.::.::.
Human   193 MKCAFSKETNCQTNSTHDPYAKAIFELSKIIFHRLYSLLYHSDII---FKLSPQGYRFQKLSRVL 254

  Fly   243 QDITDFYV---------GIVRETVKQREEQGIVRSDFMNLLIEMKQRGELTIEEMAAQAFI--FF 296
            ...||..:         |:.::...:|:.|     ||:::::..|.....:..::...:.:  |.
Human   255 NQYTDTIIQERKKSLQAGVKQDNTPKRKYQ-----DFLDIVLSAKDESGSSFSDIDVHSEVSTFL 314

  Fly   297 AAGFDTSASTLGFALYELAKQPALQAKLREEIDQALRLHNGEFTYDSMQELRYMELVIAETLRKY 361
            .||.||.|:::.:.||.||..|..|.:.|||: :.:.......|:|.:.|:.|..:.|.||.|..
Human   315 LAGHDTLAASISWILYCLALNPEHQERCREEV-RGILGDGSSITWDQLGEMSYTTMCIKETCRLI 378

  Fly   362 PILPQLTR-ISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEPHKFIPERFLADQLAQRP 425
            |.:|.::| :|:.|....|   ..:..|..:::.::|:||:||::..|..|.|.||..:...||.
Human   379 PAVPSISRDLSKPLTFPDG---CTLPAGITVVLSIWGLHHNPAVWKNPKVFDPLRFSQENSDQRH 440

  Fly   426 TAAWLPFGDGPRNCIGMRFG--KMQTTIGLVSLLRNFHFSVCPRTDPKIEFLKSNILLCPANGIY 488
            ..|:|||..|.|||||..|.  :::.||.|:.|    ||.|.|.....:.| .::.:|.|.||:|
Human   441 PYAYLPFSAGSRNCIGQEFAMIELKVTIALILL----HFRVTPDPTRPLTF-PNHFILKPKNGMY 500

  Fly   489 LKVQQLSQ 496
            |.:::||:
Human   501 LHLKKLSE 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 129/495 (26%)
CYP4X1NP_828847.1 p450 47..501 CDD:306555 126/489 (26%)
heme binding region 447..460 7/12 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.