DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a22 and Cyp4b1

DIOPT Version :9

Sequence 1:NP_001286431.1 Gene:Cyp6a22 / 49847 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_058695.2 Gene:Cyp4b1 / 24307 RGDID:2480 Length:511 Species:Rattus norvegicus


Alignment Length:478 Identity:118/478 - (24%)
Similarity:201/478 - (42%) Gaps:105/478 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 FAGFFMMLRPVVLVTDLELAKQILIQDFANFEDRGMYHNERDDPLTGHLFR------------ID 122
            |.||..:..|                |:|    :.:|  .|.||....::.            :|
  Rat    88 FVGFLNIYEP----------------DYA----KAVY--SRGDPKAADVYDFFLQWIGKGLLVLD 130

  Fly   123 GPKWRPLRQKMSPTFTSAKMKYMFPTVCEVGEELTQVCG----ELADNAMCGIL-EIGDLMARYT 182
            ||||...|:.::|.|....:|   |.|....|....:..    :.::|....|. ::|.:    .
  Rat   131 GPKWFQHRKLLTPGFHYDVLK---PYVAIFAESTRMMLDKWEKKASENKSFDIFCDVGHM----A 188

  Fly   183 SDVIGRCAFGVECNGL--RNPEAEFAIMGRRAFSERRHCKLVDGFIESF-----------PEVAR 234
            .|.:.:|.||...:||  |:.....|:.......::|        |:||           |...|
  Rat   189 LDTLMKCTFGKGDSGLGHRDNSYYLAVSDLTLLMQQR--------IDSFQYHNDFIYWLTPHGRR 245

  Fly   235 FLRMRQIHQDITDFYVGIVRETVKQR--------EEQGIVRS---DFMNLLIEMKQRG--ELTIE 286
            |||..:|..|.||       |.::||        |.:.|.:.   ||:::|:.::...  :|:..
  Rat   246 FLRACKIAHDHTD-------EVIRQRKAALQDEKERKKIQQRRHLDFLDILLGVRDESGIKLSDA 303

  Fly   287 EMAAQAFIFFAAGFDTSASTLGFALYELAKQPALQAKLREEI-----DQALRLHNGEFTYDSMQE 346
            |:.|:...|...|.||:.|.:.:.||.:|..|..|...|||:     ||      ..|.:|.:.:
  Rat   304 ELRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQQLCREEVRGILGDQ------DSFQWDDLAK 362

  Fly   347 LRYMELVIAETLRKYPILPQLTR-ISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEPHK 410
            :.|:.:.:.|..|.||.:||:.| :::.:....|..   :..|.::.:.:|.:|.:..::|:|..
  Rat   363 MTYLTMCMKECFRLYPPVPQVYRQLNKPVTFVDGRS---LPAGSLISLHIYALHRNSTVWPDPEV 424

  Fly   411 FIPERFLADQLAQRPTAAWLPFGDGPRNCIGMRFGKMQTTIGLVSLLRNFHFSVCPRTDPKIEFL 475
            |.|.||..:..|.|...|::||..|||||||.:|...:..:.....|..|.||:.|   .|:...
  Rat   425 FDPLRFSPENAAGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFSLDP---SKMPIK 486

  Fly   476 KSNILLCPANGIYLKVQQLSQMS 498
            ...::|...|||:|.::.|:..|
  Rat   487 VPQLILRSKNGIHLYLKPLASRS 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 116/469 (25%)
Cyp4b1NP_058695.2 p450 47..500 CDD:278495 115/467 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.