DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a22 and cyp-25A6

DIOPT Version :9

Sequence 1:NP_001286431.1 Gene:Cyp6a22 / 49847 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001360017.1 Gene:cyp-25A6 / 187059 WormBaseID:WBGene00019438 Length:235 Species:Caenorhabditis elegans


Alignment Length:230 Identity:60/230 - (26%)
Similarity:106/230 - (46%) Gaps:23/230 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVALLLIALAVGF--WFVRTRYSYWTRRG----IGSEPARFPVGNMEGF--RKNKHFIDIVTPIY 60
            ::..:|::| |.|  :.:..|...:..||    .|.|| .:.:||::..  ||.|...|.....|
 Worm     5 ILTSILVSL-VSFIIYVILARKERFRLRGKIGLSGPEP-HWLMGNLKQIIERKAKLGYDDSYDWY 67

  Fly    61 EKF-KGNGAPFAGFFMMLRPVVLVTDLELAKQILIQDFANFEDRG----MYHNERDDPLTGHLFR 120
            .|. |..|..| |.:...:..:.:|:.|..|::.|::|:||.||.    :..|:..:.|..:.:.
 Worm    68 NKLHKQFGETF-GIYFGTQLNINITNEEDIKEVFIKNFSNFSDRTPPPIIEDNKLKESLLQNTYE 131

  Fly   121 IDGPKWRPLRQKMSPTFTSAKMKYMFPTVCEVGEELTQVCGELADNAMCGILEIGDLMARYTSDV 185
               ..|:..|..::|.|::.|||.|..|:....:...::..|.|.:..  ..:|.|.....|.||
 Worm   132 ---SGWKHTRSAIAPIFSTGKMKAMHETIHSKVDLFLEILKEKASSGQ--KWDIYDDFQGLTLDV 191

  Fly   186 IGRCAFGVECNGLRNPEAEFAIMGRRAFS--ERRH 218
            ||:|||.::.|..|:....|.:..|:..:  :.||
 Worm   192 IGKCAFAIDSNCQRDRNDIFYVNARKFITNIDIRH 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 51/193 (26%)
cyp-25A6NP_001360017.1 p450 37..>215 CDD:386267 50/184 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - mtm4722
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.