DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a22 and cyp-33C1

DIOPT Version :9

Sequence 1:NP_001286431.1 Gene:Cyp6a22 / 49847 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_503592.2 Gene:cyp-33C1 / 183484 WormBaseID:WBGene00016686 Length:495 Species:Caenorhabditis elegans


Alignment Length:550 Identity:115/550 - (20%)
Similarity:207/550 - (37%) Gaps:154/550 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVALLLIALAVGFWFVRTRYSYWTRRGIGSEPARFPV-GNMEGFRKNKHFIDIVTP-----IYEK 62
            ::.|||..|.:.|.:    ..||.||.....|...|| ||:         :.|..|     .:|:
 Worm     2 IIILLLTFLTIYFVY----ELYWKRRNFPPGPCPLPVFGNL---------LSIANPPPGYKAFER 53

  Fly    63 FKGNGAPFAGFFMMLRPVVLVTDLELAKQILIQDFANFEDRGMYHNERDDPLT-----GHLFRID 122
            :.........|::...|.:::...:..|:..|:      |...|.|:...|:.     |....||
 Worm    54 WTKKYGDVYTFWIGNTPHIMINTWDKIKETFIR------DADTYTNKVVLPMVTLSRGGEYGIID 112

  Fly   123 --GPKWRPLRQKMSPTFTSAKMKYMFPTVCEVGEELTQVCGELADNAMCGILEIGDLMARY---- 181
              |..||..|:     |..:.|:..     .:|:.|.|      :|.   ::|:.|:.||.    
 Worm   113 SNGAMWREHRR-----FALSTMRDF-----GLGKNLMQ------ENI---LMEVQDVFARLDAKL 158

  Fly   182 -------------TSDVIGRCAFGVECNGLRNPEAE------------------FAIMGRRAFSE 215
                         .::|:.:..||....|.:..|.:                  |..|....|::
 Worm   159 GSETDVPEVFDHAVANVVNQLLFGYRFMGPKENEYQELKHIIDSPAEIFGKLHIFLAMNIPIFAK 223

  Fly   216 RRHCKLVDGFIESFPE--VARFLRMRQIHQ----------DITDFYVGIVRETVKQREEQGIVRS 268
            .....|.:|.|::|.:  :|.|.:..:.|:          :.|||....::|. |:||.:|...:
 Worm   224 LLPESLYEGPIKTFRDTTLAFFNKQIEAHRHRIDFEDLNSESTDFVETFLKEQ-KRRESEGDSET 287

  Fly   269 ----DFMNLLIEMKQRGELTIEEMAAQAFIFFAAGFDTSASTLGFALYELAKQPALQAKLREEID 329
                ..:|:.|::                  :.||.:|:.:|:.:|:..:...|.:|.|:.||:|
 Worm   288 YSNIQLLNVCIDL------------------WFAGLNTTTNTITWAISYVLHHPEVQDKIHEELD 334

  Fly   330 QAL---RLHNGEFTYDSMQELRYMELVIAETLRKYPILP-QLTRISRHLYAAKGDRHFYIEPGQM 390
            :.:   ||    .|.....:|.|....|.|:.|...||| .|...:.......|   |.|..|..
 Worm   335 KVIGSDRL----ITTADKNDLPYFNASINESQRGINILPLNLQHATTRDTVIDG---FKIPKGTG 392

  Fly   391 LLIPVYGIHHDPALYPEPHKFIPERFL--------ADQLAQRPTAAWLPFGDGPRNCIGMRFGKM 447
            ::..:..:.::..::|:|:.|.|:||:        .|:||        ||..|.|:|.|....:|
 Worm   393 VVAQISTVMNNEEVFPDPYTFNPDRFIDENGKLKKVDELA--------PFSVGKRSCPGEGLARM 449

  Fly   448 QTTIGLVSLLRNFHFSVCPRTDPKIEFLKS 477
            :..:.:.:.|..:      :..|..|.|.|
 Worm   450 ELFLFIANFLNRY------KIHPSKEGLPS 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 105/518 (20%)
cyp-33C1NP_503592.2 p450 26..470 CDD:278495 103/517 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4074
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.