DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a22 and Cyp4a32

DIOPT Version :9

Sequence 1:NP_001286431.1 Gene:Cyp6a22 / 49847 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001093651.1 Gene:Cyp4a32 / 100040843 MGIID:3717148 Length:509 Species:Mus musculus


Alignment Length:526 Identity:133/526 - (25%)
Similarity:237/526 - (45%) Gaps:83/526 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLIALAVGFWFVRTRYSYWTRRGI---GSEPARFPVGNMEGFRKNKHFIDIVTPIYEKFKGNGA 68
            |||:..||.|:..|.    |..:.:   .|.|..:..|: |.|:..:...::|:.| |.|.   :
Mouse    28 LLLLVKAVQFYLHRK----WLLKALQQFPSPPFHWFFGH-EQFKGEQELKEVVSCI-EHFP---S 83

  Fly    69 PFAGFFMMLRPVVLVTDLELAKQILIQDFANFEDRGMYHNERDDPLTGHLFR------------I 121
            .|..:|......:.|.|.:..|.||               .|.||....::|            :
Mouse    84 AFPCWFWGSNAYLTVYDPDYMKVIL---------------GRSDPKANGIYRLLAPWIGYGLLLL 133

  Fly   122 DGPKWRPLRQKMSPTF----TSAKMKYMFPTVCEVGEELTQVCGELADNAMCGILEIGDLMARYT 182
            :|..|...|:.::|.|    ....:|.|..::..:.::..::.|:  |::    :||...::..|
Mouse   134 NGQPWFQHRRMLTPAFHYDILKPYVKNMADSIRLMLDKWERLAGQ--DSS----IEIFQHISLMT 192

  Fly   183 SDVIGRCAF----GVECNGLRNPEAEFAIMG--RRAFSER-RHCKLVDGFIESFPEVARFLRMR- 239
            .|.:.:|||    .|:.:|  |.:.....:|  ...|..| |:....:..|.......|..:.. 
Mouse   193 LDTVMKCAFSHKGSVQVDG--NYKTYLQAIGDLNNLFHSRVRNIFHQNDTIYRLSSNGRLAKQAC 255

  Fly   240 QIHQDITDFYVGIVRETVKQREEQGIV-------RSDFMNLLI--EMKQRGELTIEEMAAQAFIF 295
            |:..|.||   |:::....|.:::|.:       |.||:::|:  .|:....::.:::.|:...|
Mouse   256 QLAHDHTD---GVIKMRKDQLQDEGELENIKKKRRLDFLDILLFARMENGDSMSDKDLRAEVDTF 317

  Fly   296 FAAGFDTSASTLGFALYELAKQPALQAKLREEIDQALRLHNGEFTYDSMQELRYMELVIAETLRK 360
            ...|.||:||.:.:..|.||..|..|.:.|||: |:|.......|:|.:.::.|..:.|.|.||.
Mouse   318 MFEGHDTTASGVSWIFYALATHPEHQQRCREEV-QSLLGDGSSITWDHLDQIPYTTMCIKEALRL 381

  Fly   361 YPILPQLTR-ISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEPHKFIPERFLADQLAQR 424
            ||.:|.:.| :|..:....|..   :..|..:.:.:||:||:|.::|.|..|.|.||..|  :.|
Mouse   382 YPPVPGIVRELSTSVTFPDGRS---LPKGVQVTLSIYGLHHNPKVWPNPEVFDPSRFAPD--SPR 441

  Fly   425 PTAAWLPFGDGPRNCIGMRFGKMQTTIGLVSLLRNFHFSVCPRTDP-KIEFLKSNILLCPANGIY 488
            .:.::|||..|.|||||.:|.  .:.:.::..|...||.:.|  || ::....:.|:|...||||
Mouse   442 HSHSFLPFSGGARNCIGKQFA--MSELKVIVALTLLHFELLP--DPTRVPEPLARIVLKSKNGIY 502

  Fly   489 LKVQQL 494
            |.:::|
Mouse   503 LHLKKL 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 123/490 (25%)
Cyp4a32NP_001093651.1 p450 52..503 CDD:278495 122/491 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.