DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EbpIII and a10

DIOPT Version :9

Sequence 1:NP_001286808.1 Gene:EbpIII / 49821 FlyBaseID:FBgn0011695 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_524121.2 Gene:a10 / 39906 FlyBaseID:FBgn0011293 Length:155 Species:Drosophila melanogaster


Alignment Length:99 Identity:48/99 - (48%)
Similarity:72/99 - (72%) Gaps:0/99 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EDKYTTKYDNIDVDEILKSDRLFGNYFKCLVDNGKCTPEGRELKKSLPDALKTECSKCSEKQRQN 82
            |..|..|:||:|:||||..:||..||.|||...|.|||:.:.||:.||||::|:|:||:||||..
  Fly    47 EQAYDDKFDNVDLDEILNQERLLINYIKCLEGTGPCTPDAKMLKEILPDAIQTDCTKCTEKQRYG 111

  Fly    83 TDKVIRYIIENKPEEWKQLQAKYDPDEIYIKRYR 116
            .:||.|::|:|:|.:|::|:..|||:..|..:|:
  Fly   112 AEKVTRHLIDNRPTDWERLEKIYDPEGTYRIKYQ 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EbpIIINP_001286808.1 OS-D 21..113 CDD:281395 46/91 (51%)
a10NP_524121.2 OS-D 50..141 CDD:281395 45/90 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448473
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CRZI
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27156
OrthoDB 1 1.010 - - D116230at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11257
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.