DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht4 and Chi3l1

DIOPT Version :9

Sequence 1:NP_524962.2 Gene:Cht4 / 49815 FlyBaseID:FBgn0022700 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_001296749.1 Gene:Chi3l1 / 89824 RGDID:620874 Length:391 Species:Rattus norvegicus


Alignment Length:401 Identity:153/401 - (38%)
Similarity:222/401 - (55%) Gaps:58/401 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VSIWALAALCLCLGQVASSEKLLNCYWGTWANYRPGDGKFTPSDIDPSLCTHISYTFFGISDAGE 68
            |::...|.|.|.  |..|:.||: ||:..|:.||.|:|...|..:|.||||||.|:|..||:   
  Rat    13 VALTGFAVLMLL--QSCSAYKLV-CYYTNWSQYREGNGSCFPDALDHSLCTHIIYSFANISN--- 71

  Fly    69 FKSLDT--WLDMDDGLGFISQTIALKQRNPNLKILAVVGGWNEGSTKYSAMAADPAKRATFVSTS 131
             ..|.|  |.|:.    .......||.|||.||.|..||||:.||.::|.:.::...|.|||.:.
  Rat    72 -NKLSTSEWNDVT----LYGMLNTLKTRNPRLKTLLSVGGWSFGSERFSRIVSNAKSRKTFVQSV 131

  Fly   132 LAFIQQYSFDGLDLDWEYPGQRGGSEADRENFVTLLREIKETYD---QYGLE---LGIAVGASEK 190
            ..|::.|.||||||.|.|||.:     |:::|.||::|:|..:.   |.|.|   |..||.|.:.
  Rat   132 APFLRTYGFDGLDLAWLYPGPK-----DKQHFTTLIKELKAEFTKEVQPGTEKLLLSAAVSAGKV 191

  Fly   191 SASISYDIPAISQHLTFINVMTYDFHMALDGYLGLNAPL--------PEVAESIDYWLSH----G 243
            :....||:..|:|||.|||:||||||.......|.::||        |:...::||.:.:    |
  Rat   192 TLDSGYDVAQIAQHLDFINLMTYDFHGTWRHTTGHHSPLFRGQQDTGPDRFSNVDYGVGYMLRLG 256

  Fly   244 APAEKLILGIGFYGHSYQMSDSSQNWPGAACIGPGTAGVYTRENGFLGYHEICLNNWQTVFDQEN 308
            ||..||::||..:|.|:.:: ||:|..||...|.|..|.||:|.|.|.|:|||        |...
  Rat   257 APTNKLVMGIPTFGKSFTLA-SSENQVGAPITGSGLPGRYTKEKGTLAYYEIC--------DFLR 312

  Fly   309 GA----------PYAFQGDQWIGYDNPESIQLKMQLVESRNLGGAMMWSIETDDFRG-LCGES-- 360
            ||          |:|.:|:||:|||:|||::.|::.::::.|.|||:|:::.||||| .||.:  
  Rat   313 GAEVHRILGQQVPFATKGNQWVGYDDPESVKNKVKYLKNKQLAGAMVWAVDLDDFRGSFCGHNVH 377

  Fly   361 YPLLKTMNRAL 371
            :||...:..||
  Rat   378 FPLTNAIKEAL 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht4NP_524962.2 GH18_chitolectin_chitotriosidase 26..371 CDD:119351 143/377 (38%)
Glyco_18 28..351 CDD:214753 134/352 (38%)
CBM_14 421..462 CDD:279884
Chi3l1NP_001296749.1 Glyco_18 31..365 CDD:214753 136/356 (38%)
GH18_chitolectin_chitotriosidase 32..388 CDD:119351 144/378 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350376
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 338 1.000 Inparanoid score I2302
OMA 1 1.010 - - QHG58170
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.