DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht4 and AT4G19770

DIOPT Version :9

Sequence 1:NP_524962.2 Gene:Cht4 / 49815 FlyBaseID:FBgn0022700 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_193712.2 Gene:AT4G19770 / 827721 AraportID:AT4G19770 Length:261 Species:Arabidopsis thaliana


Alignment Length:260 Identity:75/260 - (28%)
Similarity:119/260 - (45%) Gaps:39/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 MAADPAKRATFVSTSLAFIQQYSFDGLDLDWEYPGQRGGSEADRENFVTLLREIKETY--DQYGL 179
            ||:....|.:|:.::::..:.|.|||||||||||    .:.|:..:|..||:|.:...  :.|..
plant     1 MASSSYGRKSFILSTISIARSYGFDGLDLDWEYP----RNAAEMSDFAELLKEWRYAVQGEAYSS 61

  Fly   180 ELGI-----AVGASEKSASISYDIPAISQHLTFINVMTYDFH-----------MALDGYLGLNAP 228
            ||.:     .|..|.....:.|.:..||:.|.::|:..|||:           .||  ||..:.|
plant    62 ELPVLILTATVYYSSNYNGVVYPVKFISELLDWVNIKAYDFYGPGCTEVTGPPAAL--YLQSDGP 124

  Fly   229 LPEVAESIDYWLSHGAPAEKLILGIGFYGHSYQMSDSSQNWPGAACIGPGTAGVYTRENGFLGYH 293
            ..:  ..:..|:..|.||||.:||..:||.::.::|...:.......||..:     ::|.:.|.
plant   125 SGD--SGVKDWIDAGLPAEKAVLGFPYYGWAWTLADPKNHGYYVDTTGPAIS-----DDGEISYS 182

  Fly   294 EICLNNW------QTVFDQENGAPYAFQGDQWIGYDNPESIQLKMQLVESRNLGGAMMWSIETDD 352
            :  |..|      .||.|......|.:.|..|||||:.|||..|:...:.:.|.|...|.:..||
plant   183 Q--LKTWIVDNKATTVHDNIVIGDYCYAGTTWIGYDSEESIVTKVIYAKQKGLLGYFSWQVGGDD 245

  Fly   353  352
            plant   246  245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht4NP_524962.2 GH18_chitolectin_chitotriosidase 26..371 CDD:119351 75/260 (29%)
Glyco_18 28..351 CDD:214753 73/257 (28%)
CBM_14 421..462 CDD:279884
AT4G19770NP_193712.2 GH18_chitinase-like <1..250 CDD:299167 75/260 (29%)
Glyco_18 <1..244 CDD:214753 73/257 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1632
OMA 1 1.010 - - QHG58170
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.