DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht4 and AT4G19740

DIOPT Version :9

Sequence 1:NP_524962.2 Gene:Cht4 / 49815 FlyBaseID:FBgn0022700 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_193709.3 Gene:AT4G19740 / 827718 AraportID:AT4G19740 Length:211 Species:Arabidopsis thaliana


Alignment Length:218 Identity:60/218 - (27%)
Similarity:101/218 - (46%) Gaps:27/218 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 MAADPAKRATFVSTSLAFIQQYSFDGLDLDWEYPGQRGGSEADRENFVTLLREIKETYDQYGLEL 181
            ||::...|.:|:|:|::..:...|.||||.||||    .::.:..||..||:|.:...:......
plant     1 MASNRTSRESFISSSISIARSLGFYGLDLAWEYP----NNDVEMNNFGKLLQEWRSAVEVESQRT 61

  Fly   182 GI-------AVGASEKSASISYDIPAISQHLTFINVMTYDFHMALDGYLGLNAPL--PEVA---- 233
            ||       ||..:....|:||.:.||::.|.::|::.|:|: .|...:|..|.|  |.:.    
plant    62 GIRPLLLTAAVYYTSDYNSVSYPVQAINRSLDWVNLIAYEFY-GLTTEIGPPAGLYDPSIKGPCG 125

  Fly   234 -ESIDYWLSHGAPAEKLILGIGFYGHSYQMSDSSQNWPGAACIGPGTAGVYTRENGFLGYHEIC- 296
             ..:.:||..|.|.:|.:.|..:.|.|:.:.|...:....|.    |..|....||.:.|.:|. 
plant   126 DTGLKHWLKAGLPEKKAVFGFPYVGWSWTLDDDKDHGDDVAV----THRVAVTANGSINYDQIVK 186

  Fly   297 -LNNW--QTVFDQENGAPYAFQG 316
             :..:  :||:|.|....|...|
plant   187 FITEYKARTVYDSEVVGFYCIAG 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht4NP_524962.2 GH18_chitolectin_chitotriosidase 26..371 CDD:119351 60/218 (28%)
Glyco_18 28..351 CDD:214753 60/218 (28%)
CBM_14 421..462 CDD:279884
AT4G19740NP_193709.3 GH18_chitinase-like <23..211 CDD:415847 54/196 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1632
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.