DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht4 and AT4G19720

DIOPT Version :9

Sequence 1:NP_524962.2 Gene:Cht4 / 49815 FlyBaseID:FBgn0022700 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_001319998.1 Gene:AT4G19720 / 827716 AraportID:AT4G19720 Length:363 Species:Arabidopsis thaliana


Alignment Length:360 Identity:96/360 - (26%)
Similarity:160/360 - (44%) Gaps:59/360 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YWGTWANYRPGDGKFTPSD----IDPSLCTHISYTFFG---------ISDAGEFKSLDTWLDMDD 80
            ||.......|..|...|..    ||.:|.||:...|..         :|.|.|.:          
plant    10 YWFPDGASSPTTGSVVPQSSAVLIDSTLFTHLFCAFADLDPQTNSVVVSGAHEQE---------- 64

  Fly    81 GLGFISQTIALKQRNPNLKILAVVGGWNEGSTKYSAMAADPAKRATFVSTSLAFIQQYSFDGLDL 145
               |.:.|..:|::||:::.|..:||.|...:.:::||::|..|.:|:.::::..:.|.||||||
plant    65 ---FSNFTKIVKKKNPHVQTLLSIGGRNADKSAFASMASNPTSRKSFIWSAISSARYYRFDGLDL 126

  Fly   146 DWEYPGQRGGSEADRENFVTLLREIKETY-------DQYGLELGIAVGASEKSASISYDIPAISQ 203
            .|:||    ..:.:..||..||.:.:|..       ::..|.|..||..|....|:||.|..|.:
plant   127 VWKYP----KDDVEMRNFGQLLEQWREAIEDDAERTERMPLLLTAAVYYSPVYDSVSYPIREIKK 187

  Fly   204 HLTFINVMTYDFHMALDGYLGLNAPLPEVAESI----DY----WLSHGAPAEKLILGIGFYGHSY 260
            .|.::|::.|||:.: ...:|..|.|.:.:...    ||    |:..|.||:|.:||..:.|.::
plant   188 KLDWVNLIAYDFYSS-STTIGPPAALFDPSNPKGPCGDYGLKEWIKAGLPAKKAVLGFPYVGWTW 251

  Fly   261 QMSDSSQNWPGAACIGPGTAGVYTRENGFLGYHE----ICLNNWQTVFDQENGAPYAFQGDQWIG 321
            .:...:.         ..|:.|.|...|.:.|.:    |..:..:.|||......|.|.|...||
plant   252 SLGSGND---------AATSRVATSAEGSINYDQIKRLIVDHKARPVFDSTVVGDYCFAGTSLIG 307

  Fly   322 YDNPESIQLKMQLVESRNLGGAMMWSIETDDFRGL 356
            ||:.:|:..|::..:.:.|.|...|.:..||..||
plant   308 YDDHQSVVAKVKYAKQKGLLGYFSWHVGADDNFGL 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht4NP_524962.2 GH18_chitolectin_chitotriosidase 26..371 CDD:119351 96/360 (27%)
Glyco_18 28..351 CDD:214753 92/353 (26%)
CBM_14 421..462 CDD:279884
AT4G19720NP_001319998.1 GH18_plant_chitinase_class_V 3..343 CDD:119358 96/360 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1632
OMA 1 1.010 - - QHG58170
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.