DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht4 and ctbs

DIOPT Version :9

Sequence 1:NP_524962.2 Gene:Cht4 / 49815 FlyBaseID:FBgn0022700 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_001018565.1 Gene:ctbs / 553763 ZFINID:ZDB-GENE-050522-422 Length:361 Species:Danio rerio


Alignment Length:363 Identity:82/363 - (22%)
Similarity:140/363 - (38%) Gaps:76/363 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 WANYRPGDGKFTPSDIDPSLCTHIS----YTFFGISDAGE--FKSLDTWLDMDDGLGFISQTIAL 91
            |:...|.:.|        .||..||    :..| :.|.||  :|..| |..       ::...|.
Zfish    17 WSKVCPCERK--------ELCQPISSQPAFEVF-VFDVGEKAWKFYD-WTK-------VTTIAAF 64

  Fly    92 KQRNPNLKILAVVGGWN---EGSTKYSAMAADPAKRATFVSTSLAFIQQYSFDGLDLDWEYPGQR 153
            .|.:..|...|...|..   :|..:...: .||..|..::..::...:....||:::|.|...:.
Zfish    65 GQYDAELMCYAHSKGVRLVLKGDIRLPEI-VDPVNRTAWIQGNVKLAKSQFMDGINIDIEQAVET 128

  Fly   154 GGSEADRENFVTLLREIKETYDQYGLELGIAVGASEKSASIS----------YDIPAISQHLTFI 208
            |..|     :..|...:|||.:.:..|    :..|:.|..::          ||...|:.....:
Zfish   129 GSPE-----YYALTDLVKETTESFHTE----IPGSQVSFDVAWSPKCIDKRCYDYITIADSCDLL 184

  Fly   209 NVMTYDFHMAL--DGYLGLNAPLPEVAESIDYWLSHGAPAEKLILGIGFYGHSYQMSDSSQN--- 268
            .||:||....:  |.....|||..:...:.|.::|.....:||::|:.:||:.|...:.|::   
Zfish   185 FVMSYDEQSQIWGDCIAMANAPYDQTLTAYDQYISMNIDPKKLVMGVPWYGYDYSCLNFSKDGVC 249

  Fly   269 ------WPGAACIGPGTAGVYTRENGFLGYHEICLNNWQT-----VFDQENGAPYAFQGD----- 317
                  :.||.|         :..:|....:.|.:....:     ::|:|..|||....|     
Zfish   250 TIPKVPFRGAPC---------SDASGRQIPYSIMMKQINSSISGRLWDEEQRAPYYNYKDTEGMV 305

  Fly   318 QWIGYDNPESIQLKMQLVESRNLGGAMMWSIETDDFRG 355
            ..:.||:||||.||...|....|.|..||:....|:.|
Zfish   306 HQVWYDDPESIALKAAYVMQHGLKGIGMWNGNLLDYNG 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht4NP_524962.2 GH18_chitolectin_chitotriosidase 26..371 CDD:119351 82/363 (23%)
Glyco_18 28..351 CDD:214753 80/357 (22%)
CBM_14 421..462 CDD:279884
ctbsNP_001018565.1 GH18_chitobiase 5..358 CDD:119354 82/363 (23%)
Glyco_18 <95..334 CDD:214753 58/256 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.