DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht4 and LOC4578332

DIOPT Version :10

Sequence 1:NP_524962.2 Gene:Cht4 / 49815 FlyBaseID:FBgn0022700 Length:462 Species:Drosophila melanogaster
Sequence 2:XP_001237925.2 Gene:LOC4578332 / 4578332 VectorBaseID:AGAMI1_003156 Length:439 Species:Anopheles gambiae


Alignment Length:217 Identity:44/217 - (20%)
Similarity:71/217 - (32%) Gaps:69/217 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SQLFDEVDL----QSRAQLEEYRLNDDVWPTHYDIEIKPYFEPEPEKEAFTFDATTTIAVTVLKD 90
            |:.||:.|:    ..:....|....||              |.|.|||...:|          ::
Mosquito    51 SEPFDQEDILDTVPEQTDENEDEAGDD--------------ELESEKEELDYD----------EE 91

  Fly    91 NVTQIKLHKAHMNVTDWRVMRKSNSMPVGKVNETYNEETQIWTLNLKPSELVKNVEYNIVVNYVG 155
            ...:.:..:.....::.:..||.:........|...:||       |.|.:....:..|..|.:.
Mosquito    92 EDDEDRRERTSRYTSEKKGSRKDSVEGDENKKENGQDET-------KRSGIPSLFDKTITNNPMK 149

  Fly   156 RMEEDMGGFYRSYFKVNGKQVWLGSTQFEQTEARRAF---PCFDEPRYKTTFTLKLDYKPDEYNV 217
            ..::.:|...|    :.|             ||.|.|   |.|.||        ||:..|...| 
Mosquito   150 SGDQPIGVILR----IEG-------------EAERVFYPPPSFMEP--------KLNIVPRLPN- 188

  Fly   218 YANTPIVNSVPTRYNRTLATFG 239
              ..|:: .||:.:.|  |.||
Mosquito   189 --GIPLI-GVPSSHGR--AGFG 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht4NP_524962.2 GH18_chitolectin_chitotriosidase 26..371 CDD:119351 44/217 (20%)
CBM_14 420..462 CDD:426342
LOC4578332XP_001237925.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.