DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht4 and Idgf5

DIOPT Version :9

Sequence 1:NP_524962.2 Gene:Cht4 / 49815 FlyBaseID:FBgn0022700 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_611321.3 Gene:Idgf5 / 37104 FlyBaseID:FBgn0064237 Length:444 Species:Drosophila melanogaster


Alignment Length:414 Identity:114/414 - (27%)
Similarity:184/414 - (44%) Gaps:76/414 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LNCYWGTWANYRPGDGKFTPSDIDPSL--CTHISYTFFGISDAGEF--KSLDTWLDMDDGLGFIS 86
            |.|::...:..|.|..:.:.::::|:|  |..:.|.:.|| ||..:  ||||..|..|  .....
  Fly    31 LVCFYDAQSFVREGPAQMSLAELEPALQFCNFLVYGYAGI-DAVTYKIKSLDPSLTND--RQHYR 92

  Fly    87 QTIALKQRNPNLKILAVVGG----WNEG---STKYSAMAADPAKRATFVSTSLAFIQQYSFDGLD 144
            ...||:::.|:::.|..|||    .:||   |.||..:......|.:|.::.||.:....|||:|
  Fly    93 HITALRKKYPHVRFLLSVGGDRDVNSEGVADSDKYLRLLEQSEHRKSFQASVLAELNNNGFDGID 157

  Fly   145 LDWEYPGQR------------GG-------------SEADRENFVTLLREIKETYDQYGLELGIA 184
            |.|::|..|            |.             ||..||.|.|||.|::....:.|..|.::
  Fly   158 LAWQFPKNRPKLQQGVFKRVWGSLRGWFSSSSVDEKSEEHREQFATLLEELQSDLRRGGQLLTVS 222

  Fly   185 VGASEKSASISYDIPAISQHLTFINVMTYDFHMALDGYLGLNAPLP-----------EVAESIDY 238
            : ....||.:..|:|.:..::.|:|:.||||..........:.|.|           .|...:.|
  Fly   223 M-LPHVSAELFIDVPKVLSNVDFVNLGTYDFQTPERDPKVADLPTPLYAMYDRDPSHNVQYQVQY 286

  Fly   239 WLSHGA--PAEKLILGIGFYGHSYQMSDSS--QNWPG-AACIGPGTAGVYTRENGFLGYHEICLN 298
            |::..:  ...||.:|:..||.::.|:.:|  ..:|. .|..|....|..|...|.|.:.|||..
  Fly   287 WMNQTSEISVHKLHVGVTSYGRAWNMTRNSGITGYPPIPAANGAAPPGRQTVTPGLLSWPEICDL 351

  Fly   299 NWQTVFDQE------NGAP------YAF-----QGDQ--WIGYDNPESIQLKMQLVESRNLGGAM 344
            ..|...|:|      .|.|      ||:     ||:.  |:||::|.:..:|...|.::.|||..
  Fly   352 LQQQPQDREVPHLRKVGDPTKRFGIYAYRAADDQGENGLWVGYEDPLTAAIKAGFVHAQGLGGVA 416

  Fly   345 MWSIETDDFRGLC-GESYPLLKTM 367
            ...:..|||||.| ||.:|:|:::
  Fly   417 FHDLSMDDFRGQCAGEKFPILRSI 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht4NP_524962.2 GH18_chitolectin_chitotriosidase 26..371 CDD:119351 114/414 (28%)
Glyco_18 28..351 CDD:214753 103/393 (26%)
CBM_14 421..462 CDD:279884
Idgf5NP_611321.3 GH18_IDGF 30..444 CDD:119352 114/414 (28%)
Glyco_18 30..423 CDD:214753 104/395 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463803
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.