DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht4 and Idgf6

DIOPT Version :9

Sequence 1:NP_524962.2 Gene:Cht4 / 49815 FlyBaseID:FBgn0022700 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_001286499.1 Gene:Idgf6 / 36868 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster


Alignment Length:456 Identity:132/456 - (28%)
Similarity:208/456 - (45%) Gaps:98/456 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IWALAALCLCLGQVASS--------EKLLNCYWGTWANYRPGDGKFTPSDIDPSL--CTHISYTF 60
            |.|||.:.|||..:.:|        :|.|.||:.:.:..:.|.||....:::|:|  |.::.|.:
  Fly     3 IKALAIVSLCLASIQASKVGAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGY 67

  Fly    61 FGIS-DAGEFKSLDTWLDMDDGLGFISQTIALKQRNPNLKILAVVGG---------WNEGSTKYS 115
            .||. |:.:..||:..||:|.|.|.......||::.||:|||..|||         ..|...||.
  Fly    68 AGIERDSHKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYL 132

  Fly   116 AMAADPAKRATFVSTSLAFIQQYSFDGLDLDWEYPGQR-------------------GG------ 155
            .:...|..|..||:|..:.::.|.|||||:.|::|..:                   .|      
  Fly   133 ELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDE 197

  Fly   156 -SEADRENFVTLLREIKETYDQYGLELGIAVGASEKSASISYDIPAISQHLTFINVMTYDF---- 215
             ||..:|.|..|||::|..:....|.|...| ....::|:.|||||:..:|.|:|:.|:||    
  Fly   198 KSEEHKEQFTALLRDVKNAFRPDNLLLSTTV-LPNVNSSLFYDIPAVVNYLDFVNLGTFDFFTPQ 261

  Fly   216 -HMALDGYLGLNAPL-------PE--VAESIDYWLSHGAPAEKLILGIGFYGHSYQMSDSSQNWP 270
             :..:..|.   ||:       ||  ||..:.|||.:..||.|:.:|:..||..::::|.|    
  Fly   262 RNPEVADYA---APIYELSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDS---- 319

  Fly   271 GAACIGP-------GTAGVYTRENGFLGYHEIC--LNNWQTVFDQENGAP-------------YA 313
            |...:.|       ...|..|:..|...:.|:|  |.|....:.:...||             ||
  Fly   320 GDTGVPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGSYA 384

  Fly   314 F-----QGDQ--WIGYDNPESIQLKMQLVESRNLGGAMMWSIETDDFRGLC-GESYPLLKTMNRA 370
            :     :||.  |:.:::|::...|...|.:.||||..::.:..||||||| .|.||:|:.:...
  Fly   385 YRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRGLCTNEKYPILRAIKYR 449

  Fly   371 L 371
            |
  Fly   450 L 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht4NP_524962.2 GH18_chitolectin_chitotriosidase 26..371 CDD:119351 122/426 (29%)
Glyco_18 28..351 CDD:214753 110/403 (27%)
CBM_14 421..462 CDD:279884
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 122/427 (29%)
Glyco_18 31..429 CDD:214753 111/405 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463799
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 115 1.000 Inparanoid score I1336
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
65.890

Return to query results.
Submit another query.