DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht4 and btb-18

DIOPT Version :9

Sequence 1:NP_524962.2 Gene:Cht4 / 49815 FlyBaseID:FBgn0022700 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_872066.2 Gene:btb-18 / 353391 WormBaseID:WBGene00018201 Length:298 Species:Caenorhabditis elegans


Alignment Length:184 Identity:42/184 - (22%)
Similarity:64/184 - (34%) Gaps:79/184 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 TWL-DMDDGLGFISQTIALKQRNPNLKILAVVGGWNEGSTKYSAMAADPAKRATFVSTSLAFIQQ 137
            ||. ||::||..|..|                  |     |:...:.|..|   ||.|.....:|
 Worm    38 TWCEDMENGLSQIHFT------------------W-----KFDFASEDIEK---FVGTIDVKFRQ 76

  Fly   138 YSFDGLDLDWEYPGQRGGSEADRENFVTLLREIKETYDQYGLELGIAVGASEKSASISYDIPAIS 202
            |.|                    :|:||:.|.:..| |::            |.|::..:.|...
 Worm    77 YQF--------------------QNYVTVQRAVTLT-DRF------------KWATVIVENPTRR 108

  Fly   203 QHLTFINVMTYDFHMALDGYLGLNAPLPEVAESIDYWLSHGAPAEK----LILG 252
            :|   :.||   |..:|..:|   .|||...:.|      ..|:||    |::|
 Worm   109 EH---VEVM---FEYSLTPWL---RPLPFSRDEI------FLPSEKNDAVLVIG 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht4NP_524962.2 GH18_chitolectin_chitotriosidase 26..371 CDD:119351 42/184 (23%)
Glyco_18 28..351 CDD:214753 42/184 (23%)
CBM_14 421..462 CDD:279884
btb-18NP_872066.2 BTB 141..237 CDD:197585 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.