DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht4 and CG8460

DIOPT Version :9

Sequence 1:NP_524962.2 Gene:Cht4 / 49815 FlyBaseID:FBgn0022700 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_609190.2 Gene:CG8460 / 34115 FlyBaseID:FBgn0031996 Length:402 Species:Drosophila melanogaster


Alignment Length:246 Identity:57/246 - (23%)
Similarity:96/246 - (39%) Gaps:40/246 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 MAADPAKRATFVSTSLAFIQQYSFDGLDLD-WEYPGQRGGSEADRENFVTLLREIKETYDQYGLE 180
            :.:|..:|.......:...:...||||.|: |   .|..|...|:..:..:|:..||...|. |.
  Fly   172 LLSDAQERTKVNDVLIKCCKDNGFDGLVLEVW---SQLAGRIDDKILYTLVLQMAKELQKQQ-LR 232

  Fly   181 LGIAVGASEKSASISY---DIPAISQHLTFINVMTYDFHMALDGYLGLNAPLPEVAESIDYWLSH 242
            |.:.:....|.....:   .:..:.:|:...::|||||......  |.||||..|.::::.....
  Fly   233 LILVIPPFRKETGHLFGEKHMDKLFKHIYAFSLMTYDFSSVQRP--GANAPLYFVRKAVETIAPE 295

  Fly   243 G-----APAEKLILGIGFYGHSYQMSDSSQNWPGAACIGPGTAGVY----TRENGFLGYHEICLN 298
            |     |...|::||:..||:.|.....          ||.|...|    ......|.|.|..:.
  Fly   296 GCADMTAKRAKILLGLNMYGNDYTPDGG----------GPITFSQYLDLVRHVKKHLTYDERDVE 350

  Fly   299 NWQTVFDQENGAPYAFQGDQWIGYDNPESIQLKMQLVESRNLG-GAMMWSI 348
            |:   |:.:|.     .|...:.|....||..:::|  ::.|| |..:|.:
  Fly   351 NF---FEIKND-----DGRHIVFYPTLYSINERIKL--AQELGTGISIWEL 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht4NP_524962.2 GH18_chitolectin_chitotriosidase 26..371 CDD:119351 57/246 (23%)
Glyco_18 28..351 CDD:214753 57/246 (23%)
CBM_14 421..462 CDD:279884
CG8460NP_609190.2 GH18_SI-CLP 81..402 CDD:119355 57/246 (23%)
Glyco_18 86..393 CDD:214753 57/246 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463830
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.