DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht4 and Cda4

DIOPT Version :10

Sequence 1:NP_524962.2 Gene:Cht4 / 49815 FlyBaseID:FBgn0022700 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_728468.1 Gene:Cda4 / 33144 FlyBaseID:FBgn0052499 Length:486 Species:Drosophila melanogaster


Alignment Length:59 Identity:18/59 - (30%)
Similarity:27/59 - (45%) Gaps:7/59 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   408 TPGGGSGGN----ECAQ---DGFFVLESDCNKFYQCVGGVRYDFQCGAGLCFNTITLNC 459
            |...|.|..    :|..   :|.:...:.|.:|||||.|..|..:|.:||.|:.:...|
  Fly    14 TGANGQGKEKEEFQCPSHIANGNYADPATCRRFYQCVDGYPYLNRCPSGLFFDDVQKFC 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht4NP_524962.2 GH18_chitolectin_chitotriosidase 26..371 CDD:119351
CBM_14 420..462 CDD:426342 14/43 (33%)
Cda4NP_728468.1 CBM_14 33..80 CDD:426342 14/40 (35%)
CE4_CDA_like_1 130..396 CDD:200596
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.