DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht4 and Idgf4

DIOPT Version :9

Sequence 1:NP_524962.2 Gene:Cht4 / 49815 FlyBaseID:FBgn0022700 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_001285068.1 Gene:Idgf4 / 31926 FlyBaseID:FBgn0026415 Length:442 Species:Drosophila melanogaster


Alignment Length:444 Identity:126/444 - (28%)
Similarity:209/444 - (47%) Gaps:75/444 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLVSIWALAALCLCLGQV--ASSEKLLNCYWGTWANYRPGDGKFTPSDIDPSL--CTHISYTFF 61
            |||.::::|....|.:||:  |.|..|| ||:...:..|.|..|...:|::|:|  |||:.|.:.
  Fly     1 MKLYALFSLLVGSLAIGQISAAGSHHLL-CYYDGNSFVREGLSKLILTDLEPALQYCTHLVYGYA 64

  Fly    62 GIS-DAGEFKSLDTWLDMDDGLGFISQTIALKQRNPNLKILAVVGGWNE----GSTKYSAMAADP 121
            ||: .:.:..|.:..||:|.|.....|...||::.|.||:|..|||..:    .:.||..:....
  Fly    65 GINPSSNKLVSNNEKLDLDLGSSLFRQVTGLKRKYPALKVLLSVGGDKDTVDPENNKYLTLLESS 129

  Fly   122 AKRATFVSTSLAFIQQYSFDGLDLDWEYP--------GQRG------------------GSEADR 160
            ..|..|::::.:.::.|.||||||.|::|        |..|                  .:|..:
  Fly   130 NARIPFINSAHSLVKTYGFDGLDLGWQFPKNKPKKVHGSIGKFWKGFKKIFSGDHVVDEKAEEHK 194

  Fly   161 ENFVTLLREIKETYDQYGLELGIAVGASEKSASISYDIPAISQHLTFINVMTYDFHM--ALDGYL 223
            |.|..|:||:|..:...|..||::| ....::|:.:|:|||..:|.::|:.||||..  ..:...
  Fly   195 EAFTALVRELKNAFRPDGYILGLSV-LPNVNSSLFFDVPAIINNLDYVNLHTYDFQTPERNNEVA 258

  Fly   224 GLNAPLPEVAE---------SIDYWLSHGAPAEKLILGIGFYGHSYQMS-DSSQNW--PGAACIG 276
            ...||:.|:.|         .:.||..:.|||.|:.:||..||.::::: ||....  |.|...|
  Fly   259 DFPAPIYELNERNPEFNVNYQVKYWTGNRAPAAKINVGIATYGRAWKLTKDSGLTGLPPVAEADG 323

  Fly   277 PGTAGVYTRENGFLGYHEICLNNWQTVFDQENGA---------------PYAFQ-----GDQ--W 319
            ...||..|:..|.|.:.|:|............||               .||::     |:.  |
  Fly   324 VAPAGTQTQIPGLLSWPEVCAKLPNPANQHLKGADGPLRKVGDPTKRFGSYAYRSADDSGENGVW 388

  Fly   320 IGYDNPESIQLKMQLVESRNLGGAMMWSIETDDFRGLC--GESYPLLKTMNRAL 371
            :||::|::..:|.:.|:...|||..:..:..|||||.|  .:.:|:|:.:...|
  Fly   389 VGYEDPDTAAIKAEYVKREGLGGIAVVDLSFDDFRGGCTGHDKFPILRQVKSKL 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht4NP_524962.2 GH18_chitolectin_chitotriosidase 26..371 CDD:119351 115/415 (28%)
Glyco_18 28..351 CDD:214753 106/391 (27%)
CBM_14 421..462 CDD:279884
Idgf4NP_001285068.1 GH18_IDGF 26..442 CDD:119352 116/417 (28%)
Glyco_18 27..420 CDD:214753 108/394 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463798
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 115 1.000 Inparanoid score I1336
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
65.890

Return to query results.
Submit another query.