DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht4 and Muc96D

DIOPT Version :9

Sequence 1:NP_524962.2 Gene:Cht4 / 49815 FlyBaseID:FBgn0022700 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_733106.2 Gene:Muc96D / 318737 FlyBaseID:FBgn0051439 Length:881 Species:Drosophila melanogaster


Alignment Length:38 Identity:11/38 - (28%)
Similarity:20/38 - (52%) Gaps:8/38 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   425 VLESDCNKFYQCVGGVR--------YDFQCGAGLCFNT 454
            ::...|::||:|..||.        |||:..:.:.:||
  Fly    39 LVPGSCSRFYECQNGVAKEYTCPKFYDFKIRSCVTYNT 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht4NP_524962.2 GH18_chitolectin_chitotriosidase 26..371 CDD:119351
Glyco_18 28..351 CDD:214753
CBM_14 421..462 CDD:279884 11/38 (29%)
Muc96DNP_733106.2 ChtBD2 29..72 CDD:214696 9/32 (28%)
CBM_14 827..875 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.