DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht4 and Cht11

DIOPT Version :9

Sequence 1:NP_524962.2 Gene:Cht4 / 49815 FlyBaseID:FBgn0022700 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster


Alignment Length:410 Identity:124/410 - (30%)
Similarity:191/410 - (46%) Gaps:87/410 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLVSIWA---LAALCLCLG---------QVASSEKL---LNCYWGTWANYRPGDGKFTPS--DI 48
            ::.:..|:   .:.||||||         |.....|:   |.||:.:       ||....|  |:
  Fly    29 LRTLVCWSALLFSLLCLCLGFIGLGLLGIQTGEVHKVGQRLVCYYAS-------DGTHNLSLLDV 86

  Fly    49 DPSLCTHISYTFFGISDAGEFKSLD-TWLDMDDGLGFISQ--TIALKQRNPNLKILAVVGGWNEG 110
            ...|||||:     |..|    :|| ..:.:.|.|..:.|  |.:.:..:|.:.:|..:||.:.|
  Fly    87 PGDLCTHIN-----IGPA----TLDNATIVLPDTLRQVLQNDTRSFRAAHPQVHLLLWIGGADSG 142

  Fly   111 STKYSAMAADPAKRATFVSTSLAFIQQY-SFDGLDLDWEYPGQRGGSEADRE--NFVTLLREI-- 170
            .: ::.|.|:.|.|..|:.:....::.| |.||:|||||:|     |..|||  :...||.||  
  Fly   143 RS-FALMVANHAMRKLFLRSLREILRTYPSLDGIDLDWEFP-----SAYDRERMHLSQLLYEIRT 201

  Fly   171 -----KETYDQYGLELGIAVGASEKSASISYDIPAISQHLTFINVMTYDFHMALDG--YLGLNAP 228
                 |.|.|    .|.:||.|.|..|..:|||..|:.:..::|:|:||||...:.  :.|||||
  Fly   202 EWRREKRTND----ILSLAVAAPEGIAFYAYDIREINLYADYVNLMSYDFHFYREDTPFTGLNAP 262

  Fly   229 LP------------EVAESIDYWLSHGAPAEKLILGIGFYGHSYQMSDSSQNWPGAACIGPGTAG 281
            |.            .:..::.:||..|...::|::|:..||||:.:.:...:..||...|.|..|
  Fly   263 LYARSQERSLMATFNINYTVQWWLKSGLEPQRLVVGLPTYGHSFTLVNPLNHRIGAPASGYGKCG 327

  Fly   282 VYTRENGFLGYHEICLNNWQTV---------FDQENGAPYAFQGDQWIGYDNPESIQLKMQLVES 337
                :.||....|.|    :.|         :|.|:.:||.....:||.|:|..||..|...|:|
  Fly   328 ----QLGFTTLTETC----ECVTKFFKPNLSYDAESCSPYLSALQEWISYENQTSIACKANYVKS 384

  Fly   338 RNLGGAMMWSIETDDFRGLC 357
            .||||.|::|:.|||.:..|
  Fly   385 LNLGGVMVFSLNTDDLKNSC 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht4NP_524962.2 GH18_chitolectin_chitotriosidase 26..371 CDD:119351 115/370 (31%)
Glyco_18 28..351 CDD:214753 110/360 (31%)
CBM_14 421..462 CDD:279884
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 111/363 (31%)
GH18_chitinase-like 69..428 CDD:299167 115/370 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - otm46727
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.