DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht4 and Chil6

DIOPT Version :9

Sequence 1:NP_524962.2 Gene:Cht4 / 49815 FlyBaseID:FBgn0022700 Length:462 Species:Drosophila melanogaster
Sequence 2:XP_017175043.1 Gene:Chil6 / 229688 MGIID:2682303 Length:452 Species:Mus musculus


Alignment Length:402 Identity:140/402 - (34%)
Similarity:213/402 - (52%) Gaps:37/402 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLVSIWALAALCLCLGQVASSEKLLNCYWGTWANYRPGDGKFTPSDIDPSLCTHISYTFFGISDA 66
            |||.|..|.  .|...|:.|:.:|: ||:..|..::|........||||.||||:.|:|.||.: 
Mouse    20 KLVFIMGLN--LLLNAQMGSAYQLM-CYFNNWPQHQPDVRDIKHEDIDPCLCTHLIYSFAGIWE- 80

  Fly    67 GEFKSLDTWLDMDDGLGF--------ISQTIALKQRNPNLKILAVVGGWNEGSTKYSAMAADPAK 123
            ..| ::....::||..||        :.:.|....||..||.|..:|.||.|...:..|.:.|..
Mouse    81 NNF-TMTKRKELDDYKGFNDLKKRQHLWRFIHASFRNNKLKTLLSIGCWNFGDGSFITMVSTPEN 144

  Fly   124 RATFVSTSLAFIQQYSFDGLDLDWEYPGQRGGSEADRENFVTLLREIKETYDQY-------GLEL 181
            |.:|:::.:.|:::|.||||:|.|:|||..|....|:..|..|:.||::.:::.       .|.:
Mouse   145 RHSFITSIIKFLRKYGFDGLNLAWQYPGCYGSPPRDKHLFTILMHEIRKAFEKEVSKNKKPRLMV 209

  Fly   182 GIAVGASEKSASISYDIPAISQHLTFINVMTYDFHMALDGYLGLNAPL------------PEVAE 234
            ..||.....:....|:||.:||.|.:|.|||||.|.:.|||.|.|:||            ..:..
Mouse   210 TAAVAGVISTIQFGYEIPQLSQSLDYIQVMTYDLHGSWDGYTGENSPLYKSPIETGVKAFHNIKY 274

  Fly   235 SIDYWLSHGAPAEKLILGIGFYGHSYQMSDSSQNWPGAACIGPGTAGVYTRENGFLGYHEICL-- 297
            .:|.|...||..||||:|...|||::.:|||::...||.....|..|.:|::.||..|:|||.  
Mouse   275 IMDNWKKKGASPEKLIVGFPAYGHTFILSDSTKTEIGAPSNRGGHPGPHTKQTGFWAYYEICTFL 339

  Fly   298 -NNWQTVFDQENGAPYAFQGDQWIGYDNPESIQLKMQLVESRNLGGAMMWSIETDDFRG-LCGE- 359
             |....|::.....||||.|::|:||||.:|..:|.|.::..|.||||:|:|:.||:.| .||: 
Mouse   340 KNGAIQVWNAAQQVPYAFHGNEWVGYDNIKSFHIKAQWLKRNNYGGAMIWTIDMDDYTGSFCGQG 404

  Fly   360 SYPLLKTMNRAL 371
            ::||...:.:.|
Mouse   405 TFPLTSILKKTL 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht4NP_524962.2 GH18_chitolectin_chitotriosidase 26..371 CDD:119351 130/376 (35%)
Glyco_18 28..351 CDD:214753 123/352 (35%)
CBM_14 421..462 CDD:279884
Chil6XP_017175043.1 GH18_chitolectin_chitotriosidase 41..416 CDD:119351 131/377 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 339 1.000 Inparanoid score I2351
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58170
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.980

Return to query results.
Submit another query.