DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht4 and cht-4

DIOPT Version :9

Sequence 1:NP_524962.2 Gene:Cht4 / 49815 FlyBaseID:FBgn0022700 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_497437.2 Gene:cht-4 / 189507 WormBaseID:WBGene00021252 Length:360 Species:Caenorhabditis elegans


Alignment Length:350 Identity:92/350 - (26%)
Similarity:154/350 - (44%) Gaps:51/350 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SDIDPSLCTH-ISYTFFGISDAGEFKSLDTWLDMDDGL--GFISQTIALKQRNPNLKILAVVGGW 107
            |.:..:|||| |......:|:.|..:..:..|:....|  |.|...:::...||:          
 Worm    32 SKVPKNLCTHIILINSAHVSEDGRLQGFEQDLEHFSELFDGKIELFVSITSSNPS---------- 86

  Fly   108 NEGSTKYSAMAADPAKRATFVSTSLAFIQQYSFDGLDLDWEYP-GQRGGSEADRENFVTLLREIK 171
                  :|.:.::......|.||....:|:|..:|:|:|||:| ..|...::|:.:|.|.||.:|
 Worm    87 ------FSFLTSNTTLMHNFSSTVTQVLQKYRLNGVDIDWEFPVWSRDAQKSDKAHFATFLRILK 145

  Fly   172 ETYDQYGLELGIAVGASEKSASISYDIPAISQHLTFINVMTYDFHM---ALDGYLGLNAPL-PEV 232
            .......|:|.:||......:..:||:.|:..:...:.:|.||||:   ..:.::|.|||| |..
 Worm   146 SHLKPADLKLSVAVSGPPTISRKAYDVDALKMYADMVQIMNYDFHVFNRYSNPFVGFNAPLHPMR 210

  Fly   233 AE-----------SIDYWLSHGAPAEKLILGIGFYGHSYQMSDSSQNWPGAACIGPGTAGVYTRE 286
            ||           |:..|...|.|......||..|..::|:.....:.|.:..|        ...
 Worm   211 AEISVLGEMNAEASMKTWYDLGLPRNISFFGIPTYARAFQLLTHYLHKPYSPAI--------RAR 267

  Fly   287 NGFLGYHEICL----NNWQTVFDQENGAPYAFQGDQ--WIGYDNPESIQLKMQLVESRNLGGAMM 345
            .......::|:    ..:.||::....|||.: ||.  |:.|:|.:||..||.......:||.|:
 Worm   268 PEITNLPDVCIFAQSGYYTTVWNHHAQAPYLY-GDDGIWVSYENQQSILAKMAFARKLQVGGVMV 331

  Fly   346 WSIETDDFRGLCGES-YPLLKTMNR 369
            :||.:||..|.||.. ||||..:::
 Worm   332 FSIGSDDVTGKCGHGPYPLLTKISK 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht4NP_524962.2 GH18_chitolectin_chitotriosidase 26..371 CDD:119351 92/349 (26%)
Glyco_18 28..351 CDD:214753 83/329 (25%)
CBM_14 421..462 CDD:279884
cht-4NP_497437.2 GH18_chitinase-like 30..357 CDD:385673 92/349 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2365
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.