Sequence 1: | NP_524962.2 | Gene: | Cht4 / 49815 | FlyBaseID: | FBgn0022700 | Length: | 462 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_496035.1 | Gene: | chil-27 / 188616 | WormBaseID: | WBGene00011848 | Length: | 407 | Species: | Caenorhabditis elegans |
Alignment Length: | 203 | Identity: | 49/203 - (24%) |
---|---|---|---|
Similarity: | 88/203 - (43%) | Gaps: | 37/203 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 80 DGLGF--------ISQTIA-LKQR----NPNLKILAVVGGWNEGSTKYSAMA-ADPAKRATFVST 130
Fly 131 SLAFIQQYSFDGLDLDWEYPGQRGGSEADRENFVTLLRE-IKETYDQYGLELGIAVGASEKSASI 194
Fly 195 SYDIPAISQHLTFINVMTYDFHMALDGYLGLNAPLPEVAESIDYWL-SHGAPAEKLILGIGFYGH 258
Fly 259 SYQMSDSS 266 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cht4 | NP_524962.2 | GH18_chitolectin_chitotriosidase | 26..371 | CDD:119351 | 49/203 (24%) |
Glyco_18 | 28..351 | CDD:214753 | 49/203 (24%) | ||
CBM_14 | 421..462 | CDD:279884 | |||
chil-27 | NP_496035.1 | Glyco_hydro_18 | 89..>228 | CDD:279094 | 30/125 (24%) |
GH18_chitinase-like | 97..>235 | CDD:299167 | 31/132 (23%) | ||
Glyco_hydro_18 | 261..>402 | CDD:279094 | 9/32 (28%) | ||
GH18_chitinase-like | 268..>407 | CDD:299167 | 6/25 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG3325 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |