DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht4 and chil-26

DIOPT Version :9

Sequence 1:NP_524962.2 Gene:Cht4 / 49815 FlyBaseID:FBgn0022700 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_001317724.1 Gene:chil-26 / 188615 WormBaseID:WBGene00011847 Length:345 Species:Caenorhabditis elegans


Alignment Length:313 Identity:69/313 - (22%)
Similarity:108/313 - (34%) Gaps:98/313 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 FISQTIALKQRNPNLKILAVVGGWNEGSTKYSAMAADPAKRATFVSTSLAFIQQYSFDGLDLDWE 148
            |::.....|..|.|:..:..:||.|. |.|.|.|..|..|...|:.:.:.|::....||::|.| 
 Worm   108 FLNLNRKSKHINNNVNRILSIGGTNY-SEKLSIMLQDLKKTRRFIMSIIRFLKDNELDGVELLW- 170

  Fly   149 YPGQRGGSEADRENFVTLLREIKETYDQYGLELGIAVGASEKSASISYDIPAISQHLTFINVMTY 213
                  ....:...:..||:.:|     .|||      ..||..|||..:|.     |.|.    
 Worm   171 ------NRNTEETLYCELLQHLK-----MGLE------KQEKQYSISLRVPQ-----TGIG---- 209

  Fly   214 DFHMALDGYLGLNAPLPEVAESIDYWLSHGAPAEKLILGIGFYGHSYQMSDSSQNWPGAACIGPG 278
                  ..::|......|.|:||:  |...|..|..:.|.|                        
 Worm   210 ------KWHIGCELEDQENADSIN--LISMAEYENQLFGSG------------------------ 242

  Fly   279 TAGVYTRENGF-----LGYHEICLNNWQTVFDQENGAPYAFQGDQ------WIGYDNPESIQL-- 330
              ||......|     :.|| .|.:|..:.|:..  .|...|.:|      |    |||..::  
 Worm   243 --GVIRISEAFNTAWEMKYH-ACNSNQSSKFNLV--IPTIEQTEQIDMQYVW----NPEKKEIQR 298

  Fly   331 ----------KMQLVESRNLGGAMMWSIETDDFRGLCGESYPLLKTMNRALGR 373
                      |:|      :||..:||.:.|....:..:||...:..::.||:
 Worm   299 FNSSTKTEYTKLQ------MGGVSIWSRDMDYHNNIQLDSYFFERICSQELGK 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht4NP_524962.2 GH18_chitolectin_chitotriosidase 26..371 CDD:119351 67/309 (22%)
Glyco_18 28..351 CDD:214753 64/289 (22%)
CBM_14 421..462 CDD:279884
chil-26NP_001317724.1 Glyco_18 82..323 CDD:214753 64/289 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.