DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht4 and chil-7

DIOPT Version :9

Sequence 1:NP_524962.2 Gene:Cht4 / 49815 FlyBaseID:FBgn0022700 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_496131.2 Gene:chil-7 / 182437 WormBaseID:WBGene00007472 Length:482 Species:Caenorhabditis elegans


Alignment Length:359 Identity:82/359 - (22%)
Similarity:165/359 - (45%) Gaps:65/359 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 THISYTFFGISDAGE--FKSL---DTWLDMDDGLGFISQTIALKQRNPNLKILAVVGGWNEGSTK 113
            ||:.:|...::.:|.  |::|   ..:|:           |..|.:..|:|::..:|| ::.:..
 Worm   149 THLIFTNVPMNSSGHVFFENLAQRRRFLE-----------INRKAQLMNVKVMFSIGG-HKNAEH 201

  Fly   114 YSAMAADPAKRATFVSTSLAFIQQYSFDGLDLDWEYPGQRGGSEADRENFVTLLREIKETY---- 174
            ||.:.||..||:.|:.:.::||:..:..|:||.||:|     :.::..:|:|.::|:::..    
 Worm   202 YSTVVADSTKRSVFIDSIVSFIKSNNASGVDLFWEWP-----NISEMNDFITTIKELRKKLAALT 261

  Fly   175 ------DQYGLELGIAVGASEKSASISYDIPAISQHLTFINVMTYDFHMALDG----YLGLNAPL 229
                  .:|  .|.|.|.:|.........:..:..::.|:||:||.::....|    ::|.||||
 Worm   262 KAQPKGTRY--LLSIIVPSSPSDLEYYLRMDGLLHYVDFLNVLTYGYYAPWSGVNGKFVGPNAPL 324

  Fly   230 -----PEVAESIDYWLSHGAPAEKLILGIGFYGHSYQ-MSDS--SQNWPGAACIGPGTAGVYTRE 286
                 ..|.|::.|.:.......||.:.:.|||..:: ::|:  .:.:..|..|.....|:    
 Worm   325 YGGNRENVDETMQYLICKTRTPSKLNMALSFYGRYWENVNDNVPDEMFKEADLINGKAQGM---- 385

  Fly   287 NGFLGYHEICLNNW---QTVFDQENGAPYAFQGDQ--WIGYDNPESIQLKMQLVESRNLGGAMMW 346
              |:.:..:....|   :.::.:|...||.:..::  :..::|..|:|.||......|:||..:|
 Worm   386 --FVAWKNLAGRGWDKSEALWHEETQIPYIWNSEERKFFVFENERSLQAKMDYAADHNIGGVYIW 448

  Fly   347 SIETDDFRGLCGESYPLLKTMNRALGREVSGGSG 380
            ::..||      .:..||..::.|  ....||||
 Worm   449 ALGADD------NNDTLLNVVSSA--DLCEGGSG 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht4NP_524962.2 GH18_chitolectin_chitotriosidase 26..371 CDD:119351 77/348 (22%)
Glyco_18 28..351 CDD:214753 73/328 (22%)
CBM_14 421..462 CDD:279884
chil-7NP_496131.2 Glyco_18 127..453 CDD:214753 73/328 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164263
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.