DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht4 and chil-2

DIOPT Version :9

Sequence 1:NP_524962.2 Gene:Cht4 / 49815 FlyBaseID:FBgn0022700 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_496133.2 Gene:chil-2 / 182431 WormBaseID:WBGene00007466 Length:383 Species:Caenorhabditis elegans


Alignment Length:331 Identity:72/331 - (21%)
Similarity:139/331 - (41%) Gaps:77/331 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 THISYTFFGISDAGEFKSLDTWLDMDDGLGFISQTIALKQRNPNLKILAVVGGWNEGSTKYSAMA 118
            ||..:|...|...|..|    |.:.::   |.|.....|..||||||:..:.|      |:.::.
 Worm    60 THFIFTSISIFPNGTIK----WPNCEN---FESYARKAKMDNPNLKIMVEING------KFFSVL 111

  Fly   119 ADPAKRATFVSTSLAFIQQYSFDGLDLDWEYPGQRGGSEADRENFVTLLREIKETYDQYGLELGI 183
            |:..|:.:|:.:..:|:..:.|||:|:.|.:|       .|.:.|...::|.:|..         
 Worm   112 AEDEKKNSFIKSISSFVVDHKFDGVDIFWSWP-------EDEDTFHLFIKEFREKL--------- 160

  Fly   184 AVGASEKSASISYDIPAISQ------------HLTFINVMTYDFHMALDG---YLGLNAPL---- 229
                 ||...||..||.::|            |:.|:||::.:::..|.|   .:|..:||    
 Worm   161 -----EKHMIISIAIPRLAQQLEGFNLKLLMNHIDFLNVLSINYYEPLPGNGANIGPISPLYGGQ 220

  Fly   230 -PEVAESIDYWLSHGAPAEKLILGIGFYGHSYQ-----MSDSSQNWPGAACIGPGTAGVYTRENG 288
             ..|..::.|..........|.:|:.|.|..:.     :::....|.           |...|||
 Worm   221 RGNVDGTLKYLTCITKRPSILNMGVTFTGIFWNGVKDGLNEQDDIWK-----------VAQNENG 274

  Fly   289 ---FLGYHEICLNNWQTVFDQENGAPYAFQGDQ----WIGYDNPESIQLKMQLVESRNLGGAMMW 346
               .:|:.:...:...|:....:.:..::..|.    ::.::|.:|:..|:..|.::|:||.::|
 Worm   275 PGKSIGWRKFIKDRRNTIPQWHDSSKSSYAWDPKSKIFLAFENEKSLSEKVIYVRNKNIGGLVIW 339

  Fly   347 SIETDD 352
            :::.||
 Worm   340 NVDQDD 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht4NP_524962.2 GH18_chitolectin_chitotriosidase 26..371 CDD:119351 72/331 (22%)
Glyco_18 28..351 CDD:214753 70/328 (21%)
CBM_14 421..462 CDD:279884
chil-2NP_496133.2 Glyco_18 42..344 CDD:214753 70/328 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164264
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.