DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht4 and lmd-4

DIOPT Version :10

Sequence 1:NP_524962.2 Gene:Cht4 / 49815 FlyBaseID:FBgn0022700 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_504862.2 Gene:lmd-4 / 179121 WormBaseID:WBGene00017233 Length:2011 Species:Caenorhabditis elegans


Alignment Length:39 Identity:10/39 - (25%)
Similarity:16/39 - (41%) Gaps:0/39 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 LKALGNWVDYPFNSVPEITRMYMAAIPDFAAGAMENWGL 325
            |..|.:::.|.:||......:...|.|..|.|....|.:
 Worm    67 LPVLNSYLHYTYNSSNSSLSVAFVATPSQANGGWVAWAI 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht4NP_524962.2 GH18_chitolectin_chitotriosidase 26..371 CDD:119351 10/39 (26%)
CBM_14 420..462 CDD:426342
lmd-4NP_504862.2 PRK06347 <22..351 CDD:180536 10/39 (26%)
LysM 142..185 CDD:197609
LysM 209..250 CDD:197609
LysM 270..313 CDD:197609
LysM 334..377 CDD:197609
LysM 401..444 CDD:197609
PRK06347 <445..726 CDD:180536
LysM 550..590 CDD:197609
LysM 635..678 CDD:197609
LysM 710..750 CDD:197609
LysM 760..802 CDD:197609
Self-incomp_S1 1359..1429 CDD:461784
Glyco_18 1480..1825 CDD:214753
ChtBD1_GH18_2 1873..1924 CDD:211315
ChtBD1_GH18_2 1951..2002 CDD:211315
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.