DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht4 and chil-8

DIOPT Version :9

Sequence 1:NP_524962.2 Gene:Cht4 / 49815 FlyBaseID:FBgn0022700 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_001379090.1 Gene:chil-8 / 174541 WormBaseID:WBGene00007473 Length:399 Species:Caenorhabditis elegans


Alignment Length:387 Identity:84/387 - (21%)
Similarity:168/387 - (43%) Gaps:62/387 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WALAALCLCL----GQVASSEKLLNCYWGTWAN--------YRPGDGKFTPSDIDPSL------- 52
            :.||.|...|    |.|:.....|.||:..::|        :|.....:..||....:       
 Worm     5 YKLAILIFVLLFVFGIVSFLVSSLFCYFYDFSNSVQSPSVLHRKRIIGYVSSDEGSEITIKQLEK 69

  Fly    53 CTHISYTFFGISDAGEFKSLDTWLDMDDGLGFISQTIALKQRNPNLKILAVVGGWNEGSTKYSAM 117
            .||:.:.|..:...|..|......|     ||........:.|..||::..:||: |.|..:|.:
 Worm    70 LTHVIFAFILVHKDGTIKFKYGTKD-----GFFDMKRKSMELNRGLKVMVSIGGY-ESSPLFSDV 128

  Fly   118 AADPAKRATFVSTSLAFIQQYSFDGLDLDWEYPGQRGGSEADRENFVTLLREIKETY----DQYG 178
            ..  .|:...:::....::::..||:|:.|.:|     |..|:.|::..:||:::..    |:.|
 Worm   129 LV--KKKKKLIASIALLVKKFDLDGVDIFWNWP-----SITDQSNYLIFIRELRKKLTNLKDENG 186

  Fly   179 LE----LGIAVGASEKSASISYDIPAISQHLTFINVMTYDFHMALDGYLGLNAPL-----PEVAE 234
            ..    :.:...:|...:...|....|.:::.||||:|:::....: .:|.::||     ..|.:
 Worm   187 RSNEYVISVIAPSSSSHSEYPYKWTEILENVDFINVITFEYFYEAN-KIGPHSPLYGGSFGNVDD 250

  Fly   235 SIDYWLSHGAPAEKLILGIGF----YGHSYQMSDSSQNW-PGAACIGPGTAG--VYTRENGFLGY 292
            ::.|.:.......||.:.:.|    :|::....|....| |..:..||.:.|  .:.|.:     
 Worm   251 TLKYLICRTRTPNKLNMVVSFNGIYWGNTTLPFDDKGVWIPDDSAQGPYSYGWKQFARMS----- 310

  Fly   293 HEICLNNWQTVFDQENGAPYAFQGD--QWIGYDNPESIQLKMQLVESRNLGGAMMWSIETDD 352
            |....|:::  :::|...||.::.|  |::.::|.:|:..||....:.|:||..|::|:.||
 Worm   311 HGFDQNDFE--WNEETRTPYIWKADTQQFLTFENEKSLTEKMNYAVAHNIGGVAMYTIDDDD 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht4NP_524962.2 GH18_chitolectin_chitotriosidase 26..371 CDD:119351 78/364 (21%)
Glyco_18 28..351 CDD:214753 75/359 (21%)
CBM_14 421..462 CDD:279884
chil-8NP_001379090.1 Glyco_18 49..369 CDD:214753 71/340 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164262
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.