DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht4 and CTBS

DIOPT Version :9

Sequence 1:NP_524962.2 Gene:Cht4 / 49815 FlyBaseID:FBgn0022700 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_004379.1 Gene:CTBS / 1486 HGNCID:2496 Length:385 Species:Homo sapiens


Alignment Length:415 Identity:89/415 - (21%)
Similarity:146/415 - (35%) Gaps:133/415 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLVSIWALAALCLCLGQVASSEKLLNCYWGTWANYRPGDGKFTPSDIDPSLCT----HISYTFF 61
            :.|:::.||.||.|..|        .:|                |.. :|.||.    |..:..|
Human    22 LALLALLALLALRLAAG--------TDC----------------PCP-EPELCRPIRHHPDFEVF 61

  Fly    62 GISDAGEFKSLDTWLDMDDGLGFISQTIALKQRNPNLKILAVVGGWNEGST-----KYSAM---- 117
             :.|.|:    .||...|                           |::.:|     ||.:.    
Human    62 -VFDVGQ----KTWKSYD---------------------------WSQITTVATFGKYDSELMCY 94

  Fly   118 ------------------AADPAKRATFVSTSLAFIQQYSFDGLDLDWEYPGQRGGSEADRENFV 164
                              ..|||.||::::..|...:....||:::|.|........|.|     
Human    95 AHSKGARVVLKGDVSLKDIIDPAFRASWIAQKLNLAKTQYMDGINIDIEQEVNCLSPEYD----- 154

  Fly   165 TLLREIKETYDQY-----GLELGIAVGASEKSAS-ISYDIPAISQHLTFINVMTYDFHMAL--DG 221
            .|...:|||.|.:     |.::...|..|.|:.. ..|:...|:....|:.||:||....:  :.
Human   155 ALTALVKETTDSFHREIEGSQVTFDVAWSPKNIDRRCYNYTGIADACDFLFVMSYDEQSQIWSEC 219

  Fly   222 YLGLNAPLPEVAESIDYWLSHGAPAEKLILGIGFYGHSYQMSDSSQN---------WPGAACIGP 277
            ....|||..:.....:.::......:||::|:.:||:.|...:.|::         :.||.|  .
Human   220 IAAANAPYNQTLTGYNDYIKMSINPKKLVMGVPWYGYDYTCLNLSEDHVCTIAKVPFRGAPC--S 282

  Fly   278 GTAG-------VYTRENGFLGYHEICLNNWQTVFDQENGAPYAFQGD-----QWIGYDNPESIQL 330
            ..||       :..:.|.     .|..|.|    |::..|||....|     ..:.||||:||.|
Human   283 DAAGRQVPYKTIMKQINS-----SISGNLW----DKDQRAPYYNYKDPAGHFHQVWYDNPQSISL 338

  Fly   331 KMQLVESRNLGGAMMWSIETDDFRG 355
            |...:::..|.|..||:....|:.|
Human   339 KATYIQNYRLRGIGMWNANCLDYSG 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht4NP_524962.2 GH18_chitolectin_chitotriosidase 26..371 CDD:119351 82/390 (21%)
Glyco_18 28..351 CDD:214753 80/382 (21%)
CBM_14 421..462 CDD:279884
CTBSNP_004379.1 GH18_chitobiase 39..378 CDD:119354 82/390 (21%)
Glyco_18 <115..358 CDD:214753 64/258 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.