DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht4 and T19H5.6

DIOPT Version :9

Sequence 1:NP_524962.2 Gene:Cht4 / 49815 FlyBaseID:FBgn0022700 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_001254213.1 Gene:T19H5.6 / 13186491 WormBaseID:WBGene00044807 Length:286 Species:Caenorhabditis elegans


Alignment Length:188 Identity:45/188 - (23%)
Similarity:82/188 - (43%) Gaps:33/188 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YRPGDGKFTPSDIDPSLCTHISYTFFGISDAGEFKSLDTWLDMDDGLGFISQT-----IALKQ-- 93
            |..|..|...:..:.|..||..:.|             .::..|..|.|.:|.     :.||:  
 Worm    73 YYAGTEKSQITIEEVSELTHAVFAF-------------VYMATDGTLMFSNQAQRNRFLKLKELT 124

  Fly    94 --RNPNLKILAVVGGWNEGSTKYSAMAADPAKRATFVSTSLAFIQQYSFDGLDLDWEYPGQRGGS 156
              .|..:|::..:|| .:.|..:|.:.|.|.::.:|::..|..:::|..||:||.|.:|     .
 Worm   125 KNENSTVKMMFSIGG-KDNSQNFSPVTASPDRKKSFINAILELLEKYDLDGVDLFWRWP-----K 183

  Fly   157 EADRENFVTLLREIKETY----DQYGLELGIAVGASEKSASISYDIPAISQHLTFINV 210
            ..|::.:...|||:|:..    ..|.|.:.:|.....:..| .:||..|.:|..||::
 Worm   184 SDDKDEYAVFLRELKKQLKARRKDYILSVVVAPLDINRWDS-KFDIKKIIKHADFISI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht4NP_524962.2 GH18_chitolectin_chitotriosidase 26..371 CDD:119351 45/188 (24%)
Glyco_18 28..351 CDD:214753 45/188 (24%)
CBM_14 421..462 CDD:279884
T19H5.6NP_001254213.1 Glyco_18 69..>255 CDD:214753 45/188 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164275
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.