DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht4 and LOC100494478

DIOPT Version :9

Sequence 1:NP_524962.2 Gene:Cht4 / 49815 FlyBaseID:FBgn0022700 Length:462 Species:Drosophila melanogaster
Sequence 2:XP_002931718.1 Gene:LOC100494478 / 100494478 -ID:- Length:361 Species:Xenopus tropicalis


Alignment Length:433 Identity:91/433 - (21%)
Similarity:156/433 - (36%) Gaps:149/433 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVSIWAL---------AALCLCLGQVASSEKLLNCYWGTWANYRPGDGKFTPSDIDPSLCTHISY 58
            |.::|:|         ::||.||                                ||:||..::.
 Frog     8 LGALWSLLFLMKILLCSSLCPCL--------------------------------DPALCEPVAE 40

  Fly    59 T------FFGISDAGEFKSLDTWLDMDDGLGFISQTIALKQRNPNLKILA-------VVGGWNEG 110
            |      .|.:.:       ..||..|  ...|:......:..|:|...|       |:.|  :.
 Frog    41 TRDFEVFVFHVRE-------KNWLLYD--WTQITTVATFAEYEPDLMCFAHSKGVRYVLSG--DV 94

  Fly   111 STKYSAMAADPAKRATFVSTSLAFIQQYSFDGLDLDWEYPGQRGGSEADRENFVTLLREIKETYD 175
            |.|   ...||..|..:::..|...|....||.:||.|.|..:|..|     :..|...::||.:
 Frog    95 SLK---DIVDPKIRTAWITEKLELAQSQFMDGFNLDIEQPVLKGSPE-----YYALTALVQETTE 151

  Fly   176 QYGLELGIAVGASEKSASISYDIP--------------AISQHLTFINVMTYDF--HMALDGYLG 224
            .:..|:        ..:.:::|:|              .|:....|:.||:||.  .:..:...|
 Frog   152 AFHREI--------PGSQVTFDVPWAPNCVAARCYNYTGIADLCDFLFVMSYDMPPQLFTEWVAG 208

  Fly   225 LNAPLPEVAESIDYWLSHGAPAEKLILGIGFYGHSYQMSDSSQNWPGAACIGPGTAGVYTRENGF 289
            .|:|..|.....|.:::.|...:||::||.:||:.|:            |:      ..|::|..
 Frog   209 ANSPYNETLTGYDQFINLGINPKKLVMGIPWYGYDYE------------CL------KLTKDNKC 255

  Fly   290 LGYHEICLNN------WQTVFDQENGAPYAFQGDQW--------------------IGYDNPESI 328
            :.:.|..|::      :.|:..|.|.   :..|..|                    :.||:||||
 Frog   256 ILFKESLLDSAAQQVPYSTIMKQLNS---SLSGRLWDDFQKSPFFNYLDTQGNIHQVWYDDPESI 317

  Fly   329 QLKMQLVESRNLGGAMMWSIETDDFRGLCGESYPLLKTMNRAL 371
            .||...|..|:|.|..||:.:|.|:     .|.|:.|...:.:
 Frog   318 SLKAAYVPKRSLRGIGMWNADTLDY-----SSDPVSKKQTKMM 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht4NP_524962.2 GH18_chitolectin_chitotriosidase 26..371 CDD:119351 84/399 (21%)
Glyco_18 28..351 CDD:214753 79/377 (21%)
CBM_14 421..462 CDD:279884
LOC100494478XP_002931718.1 GH18_chitobiase 10..359 CDD:119354 90/431 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.