DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4H1 and EIF4H

DIOPT Version :9

Sequence 1:NP_001285330.1 Gene:eIF4H1 / 49809 FlyBaseID:FBgn0262734 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_071496.1 Gene:EIF4H / 7458 HGNCID:12741 Length:248 Species:Homo sapiens


Alignment Length:380 Identity:121/380 - (31%)
Similarity:165/380 - (43%) Gaps:151/380 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GRGGYEHARSGFGGDRASKQLPTEPPFIAFVGNLPQGLVQGDVIKIFQDFEVKYVRLVKDRETDQ 67
            |||  ....:|..|.|:.|:||||||:.|:|||||...||||:..||:|..::.||||:|::||:
Human    18 GRG--SRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSVRLVRDKDTDK 80

  Fly    68 FKGFCYVEFETLDNLERALECDGRIKLDDLSAPLRIDIADRRKNDRPGGGVGGGNGGMTRGDGGR 132
            |||||||||:.:|:|:.||..||.: |.|.|  ||:|||:.||.|:         ||.       
Human    81 FKGFCYVEFDEVDSLKEALTYDGAL-LGDRS--LRVDIAEGRKQDK---------GGF------- 126

  Fly   133 DGFQKRGPPRQG-GSSQSYSRGGPGTGGGGREGGGGSGNRGDSRGSYIDSYGGHNDRSRGVGGSG 196
             ||:|.||..:| |||              ||..||..:|.|....:.|.:.|      |.||| 
Human   127 -GFRKGGPDDRGMGSS--------------RESRGGWDSRDDFNSGFRDDFLG------GRGGS- 169

  Fly   197 AGSGGGMNRGYNDRPANRGRYGSFNNDDRPFERNQDRDRGQREG-SYGNQSRDGDRYNNFNRHRD 260
                         ||.:|                       |.| ..|::.|||....       
Human   170 -------------RPGDR-----------------------RTGPPMGSRFRDGPPLR------- 191

  Fly   261 RERTHYNPNQQSERPSGGMTGLGGGSGGSGGLGVGGGSSMGAIDNFRHFKKPISRIISNMCQSRV 325
                                                ||:|       .|::|..       :.|.
Human   192 ------------------------------------GSNM-------DFREPTE-------EERA 206

  Fly   326 SQLAVPRTNDNERPRLQLKPRTIAAPINAVAETKQSASIFGNAKPREEKLKELQQ 380
                       :||||||||||:|.|:|.||  ..:::|||.|:||||.:::.|:
Human   207 -----------QRPRLQLKPRTVATPLNQVA--NPNSAIFGGARPREEVVQKEQE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4H1NP_001285330.1 RRM <19..>139 CDD:223796 58/119 (49%)
RRM_eIF4H 28..106 CDD:240847 42/77 (55%)
EIF4HNP_071496.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 11/24 (46%)
RRM_eIF4H 37..120 CDD:409835 48/85 (56%)
SF-CC1 <40..>227 CDD:273721 101/333 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..248 62/270 (23%)
HHV-1 Vhs binding site 137..157 10/33 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140670
Domainoid 1 1.000 83 1.000 Domainoid score I8353
eggNOG 1 0.900 - - E33208_3BCZ7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I3975
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1530583at2759
OrthoFinder 1 1.000 - - FOG0006177
OrthoInspector 1 1.000 - - otm41666
orthoMCL 1 0.900 - - OOG6_107509
Panther 1 1.100 - - LDO PTHR23236
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1292
SonicParanoid 1 1.000 - - X4457
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.