DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4H1 and Cstf2

DIOPT Version :10

Sequence 1:NP_001285330.1 Gene:eIF4H1 / 49809 FlyBaseID:FBgn0262734 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001421314.1 Gene:Cstf2 / 683927 RGDID:1596566 Length:624 Species:Rattus norvegicus


Alignment Length:112 Identity:33/112 - (29%)
Similarity:47/112 - (41%) Gaps:21/112 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LPTEPPFI------AFVGNLPQGLVQGDVIKIFQDF-EVKYVRLVKDRETDQFKGFCYVEFETLD 80
            ||...|.:      .||||:|....:..:..||.:. .|...|||.||||.:.||:.:.|::..:
  Rat     4 LPVRDPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQE 68

  Fly    81 NLERAL------ECDGRIKLDDLSAPLRIDIADRRKNDRPGGGVGGG 121
            ....|:      |..||        .||:|.|...||......:|.|
  Rat    69 TALSAMRNLNGREFSGR--------ALRVDNAASEKNKEELKSLGTG 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4H1NP_001285330.1 RRM_eIF4H 24..110 CDD:409835 28/98 (29%)
Cstf2NP_001421314.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 26/91 (29%)
CSTF2_hinge 112..191 CDD:433869
CSTF_C 580..620 CDD:464130
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.