DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4H1 and rbm39a

DIOPT Version :10

Sequence 1:NP_001285330.1 Gene:eIF4H1 / 49809 FlyBaseID:FBgn0262734 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001012304.1 Gene:rbm39a / 406251 ZFINID:ZDB-GENE-040426-2852 Length:523 Species:Danio rerio


Alignment Length:119 Identity:30/119 - (25%)
Similarity:47/119 - (39%) Gaps:47/119 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ARSGFGGDRASKQLPTEPPFIAFVGNL-PQGLVQGDVIKIF----------QDFE--------VK 55
            :||.|..||:    |...|    :.|| |:   :.|...:|          :|.|        |:
Zfish   123 SRSPFKKDRS----PVRQP----IDNLTPE---ERDARTVFCMQLAARIRPRDLEEFFSAVGKVR 176

  Fly    56 YVRLVKDRETDQFKGFCYVEFETLDNLERALECDGRIKLDDLSAPLRIDIADRR 109
            .||::.||.:.:.||..|:||                 :|..|.||.|.::.:|
Zfish   177 DVRIISDRNSRRSKGIAYIEF-----------------VDSTSVPLAIGLSGQR 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4H1NP_001285330.1 RRM_eIF4H 24..110 CDD:409835 25/105 (24%)
rbm39aNP_001012304.1 SF-CC1 91..511 CDD:273721 30/119 (25%)

Return to query results.
Submit another query.