DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4H1 and eif4h

DIOPT Version :9

Sequence 1:NP_001285330.1 Gene:eIF4H1 / 49809 FlyBaseID:FBgn0262734 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001184257.1 Gene:eif4h / 402996 ZFINID:ZDB-GENE-010328-19 Length:262 Species:Danio rerio


Alignment Length:373 Identity:133/373 - (35%)
Similarity:165/373 - (44%) Gaps:133/373 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GGYEHARSGFG--GDRASKQLPTEPPFIAFVGNLPQGLVQGDVIKIFQDFEVKYVRLVKDRETDQ 67
            ||....|.|.|  |.|..|:||||||:.|:|||||...||||:..||:|..|:.||||:|:|||:
Zfish    18 GGGRGPRGGGGPSGPRKQKELPTEPPYTAYVGNLPFNTVQGDIDAIFRDLSVRSVRLVRDKETDK 82

  Fly    68 FKGFCYVEFETLDNLERALECDGRIKLDDLSAPLRIDIADRRKNDRPGGGVGGGNGGMTRGDGGR 132
            |||||||||:.|::|:.||..||.: |.|.|  ||:|||:.|:.:|     |||..|..:.|.||
Zfish    83 FKGFCYVEFDDLESLKEALTYDGAL-LGDRS--LRVDIAEGRRQER-----GGGGFGFRKDDRGR 139

  Fly   133 DGFQKRGPPRQGGSSQSYSRGGPGTGGGGREGGGGSGNRGDSRGSYIDSYGGHNDRSRGVGGSGA 197
                       |||.        |..||||          |||..:        |:|   ||..|
Zfish   140 -----------GGSR--------GARGGGR----------DSREDF--------DQS---GGGAA 164

  Fly   198 GSGGGMNRGYNDRPANRGRYGSFNNDDRPFERNQDRDRGQREGSYGNQSRDGDRYNNFNRHRDRE 262
            |..|                  |.:||                ..|.:||.|.            
Zfish   165 GEMG------------------FRDDD----------------FMGGRSRGGG------------ 183

  Fly   263 RTHYNPNQQSERPSGGMTGLGGGSGGSGGLG-VGGGSSMGAIDNFRHFKKPISRIISNMCQSRVS 326
                       ||.....|.|||.||.||:| ...|...|...:||.                  
Zfish   184 -----------RPGDRRGGAGGGGGGGGGMGRFRDGPPRGGQTDFRE------------------ 219

  Fly   327 QLAVPRTNDN-ERPRLQLKPRTIAAPINAVAETKQSASIFGNAKPREE 373
                |...:. :||||||||||:|.|:|.||  ..:::|||.||||||
Zfish   220 ----PSDEERAQRPRLQLKPRTVAGPLNQVA--NPNSAIFGGAKPREE 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4H1NP_001285330.1 RRM <19..>139 CDD:223796 61/119 (51%)
RRM_eIF4H 28..106 CDD:240847 44/77 (57%)
eif4hNP_001184257.1 RRM <39..>118 CDD:223796 48/81 (59%)
RRM_eIF4H 43..118 CDD:240847 44/77 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573382
Domainoid 1 1.000 80 1.000 Domainoid score I8534
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 154 1.000 Inparanoid score I4292
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1530583at2759
OrthoFinder 1 1.000 - - FOG0006177
OrthoInspector 1 1.000 - - otm24970
orthoMCL 1 0.900 - - OOG6_107509
Panther 1 1.100 - - LDO PTHR23236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4457
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.