DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4H1 and Pabp2

DIOPT Version :9

Sequence 1:NP_001285330.1 Gene:eIF4H1 / 49809 FlyBaseID:FBgn0262734 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster


Alignment Length:152 Identity:36/152 - (23%)
Similarity:56/152 - (36%) Gaps:27/152 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FVGNLPQGLVQGDVIKIFQDF-EVKYVRLVKDRETDQFKGFCYVEFETLDNLERALECDGRIKLD 95
            :|||:..|....::...|... .:..|.::.::.....|||.|:||.:.:.:|.||..:     :
  Fly    99 YVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMN-----E 158

  Fly    96 DLSAPLRIDIADRRKNDRPGGGVGGGNGGMTRGDGGRDGFQKRGPPRQGGSSQSYSRGGPGTGGG 160
            .|....:|.:..:|.| |||..        |.....|..|:.||.........|..||       
  Fly   159 TLFRGRQIKVMSKRTN-RPGLS--------TTNRFARGSFRGRGARVSRACCHSTFRG------- 207

  Fly   161 GREGGGGSGNRGDSRGSYIDSY 182
               .....|.||  |.:|...|
  Fly   208 ---ARRAMGYRG--RANYYAPY 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4H1NP_001285330.1 RRM <19..>139 CDD:223796 25/107 (23%)
RRM_eIF4H 28..106 CDD:240847 17/74 (23%)
Pabp2NP_476902.1 RRM <43..>172 CDD:223796 17/77 (22%)
RRM_II_PABPN1 97..172 CDD:240994 17/77 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23236
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.