DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4H1 and Eif4b

DIOPT Version :9

Sequence 1:NP_001285330.1 Gene:eIF4H1 / 49809 FlyBaseID:FBgn0262734 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001008325.1 Gene:Eif4b / 300253 RGDID:1306479 Length:611 Species:Rattus norvegicus


Alignment Length:409 Identity:106/409 - (25%)
Similarity:153/409 - (37%) Gaps:140/409 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DRASKQLPTEPPFIAFVGNLPQGLVQGDVIKIFQDFEVKYVRLVKD-RETDQFKGFCYVEFETLD 80
            ||:  :||..||:.||:||||..:.:..:...|:...:..|||.:: ...|:.|||.|.|||.||
  Rat    86 DRS--RLPKSPPYTAFLGNLPYDVTEDSIKDFFRGLNISAVRLPREPSNPDRLKGFGYAEFEDLD 148

  Fly    81 NLERALECDGRIKLDDL-SAPLRIDIA----DRRKNDRPGGGVGGGNGGMT----RGDGGRDGFQ 136
            :|..||.    :..:.| :..:|:|:|    |:.::||..|.....:...|    |.....|.|.
  Rat   149 SLLSALS----LNEESLGNRRIRVDVADQAQDKDRDDRSFGRDRNRDSDKTDTDWRARPATDSFD 209

  Fly   137 KRGPPRQGGSSQSYSRGGPGTGGGGREGGGGSGNRGDSRGSYIDSYGGHNDRSRGVGGSGAGSGG 201
            .. |||:|..|                       .||   .|.|.|  .:||.|          .
  Rat   210 DY-PPRRGDDS-----------------------FGD---KYRDRY--ESDRYR----------D 235

  Fly   202 GMNRGYNDRP-ANRGRYGSFNNDDRPFERNQDRDRGQREGS----YGNQSR-------DGDRY-N 253
            |...||.|.| .:..|||..:..|....|:.||....|.||    :|:..|       .|||| :
  Rat   236 GYRDGYRDGPRRDMDRYGGRDRYDDRGSRDYDRGYDSRIGSGRRAFGSGYRRDDDYRGGGDRYED 300

  Fly   254 NFNRHRDR---ERTHYNPNQQSERPSGGMTGLGGGSGGSGGLGVGGGSSMGAIDNFRHFKKPISR 315
            .::|..||   .|..|:.                                   |::|...:    
  Rat   301 RYDRRDDRSWSSRDDYSR-----------------------------------DDYRRDDR---- 326

  Fly   316 IISNMCQSRVSQLAVPRTNDNERPRLQLKPRTIAAPINAVAETKQS---ASIFGNAKP------- 370
                              ...:||:|.||||:.....::.|.|.||   |||||.|||       
  Rat   327 ------------------GPPQRPKLNLKPRSTPKEDDSSASTSQSSRAASIFGGAKPVDTAARE 373

  Fly   371 --REEKLKELQQNVNHNGD 387
              .||:|::.|:.:....|
  Rat   374 REVEERLQKEQEKLQRQLD 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4H1NP_001285330.1 RRM <19..>139 CDD:223796 39/129 (30%)
RRM_eIF4H 28..106 CDD:240847 27/79 (34%)
Eif4bNP_001008325.1 RRM <83..>190 CDD:223796 37/109 (34%)
RRM_eIF4B 95..171 CDD:240848 27/79 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1530583at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.