DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4H1 and EIF4B

DIOPT Version :9

Sequence 1:NP_001285330.1 Gene:eIF4H1 / 49809 FlyBaseID:FBgn0262734 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001287750.1 Gene:EIF4B / 1975 HGNCID:3285 Length:616 Species:Homo sapiens


Alignment Length:409 Identity:105/409 - (25%)
Similarity:154/409 - (37%) Gaps:140/409 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DRASKQLPTEPPFIAFVGNLPQGLVQGDVIKIFQDFEVKYVRLVKD-RETDQFKGFCYVEFETLD 80
            ||:  :||..||:.||:||||..:.:..:.:.|:...:..|||.:: ...::.|||.|.|||.||
Human    86 DRS--RLPKSPPYTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFGYAEFEDLD 148

  Fly    81 NLERALECDGRIKLDDL-SAPLRIDIA----DRRKNDRPGGGVGGGNGGMT----RGDGGRDGFQ 136
            :|..||.    :..:.| :..:|:|:|    |:.::||..|.....:...|    |.....|.|.
Human   149 SLLSALS----LNEESLGNRRIRVDVADQAQDKDRDDRSFGRDRNRDSDKTDTDWRARPATDSFD 209

  Fly   137 KRGPPRQGGSSQSYSRGGPGTGGGGREGGGGSGNRGDSRGSYIDSYGGHNDRSRGVGGSGAGSGG 201
            .. |||:|..|                       .||   .|.|.|  .:||.|          .
Human   210 DY-PPRRGDDS-----------------------FGD---KYRDRY--DSDRYR----------D 235

  Fly   202 GMNRGYNDRP-ANRGRYGSFNNDDRPFERNQDRDRGQREGS----YGNQSR-------DGDRY-N 253
            |...||.|.| .:..|||..:..|....|:.||....|.||    :|:..|       .|||| :
Human   236 GYRDGYRDGPRRDMDRYGGRDRYDDRGSRDYDRGYDSRIGSGRRAFGSGYRRDDDYRGGGDRYED 300

  Fly   254 NFNRHRDR---ERTHYNPNQQSERPSGGMTGLGGGSGGSGGLGVGGGSSMGAIDNFRHFKKPISR 315
            .::|..||   .|..|:.                                   |::|...:    
Human   301 RYDRRDDRSWSSRDDYSR-----------------------------------DDYRRDDR---- 326

  Fly   316 IISNMCQSRVSQLAVPRTNDNERPRLQLKPRTIAAPINAVAETKQS---ASIFGNAKP------- 370
                              ...:||:|.||||:.....::.|.|.||   |||||.|||       
Human   327 ------------------GPPQRPKLNLKPRSTPKEDDSSASTSQSTRAASIFGGAKPVDTAARE 373

  Fly   371 --REEKLKELQQNVNHNGD 387
              .||:|::.|:.:....|
Human   374 REVEERLQKEQEKLQRQLD 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4H1NP_001285330.1 RRM <19..>139 CDD:223796 38/129 (29%)
RRM_eIF4H 28..106 CDD:240847 26/79 (33%)
EIF4BNP_001287750.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 66..93 4/8 (50%)
RRM <83..>190 CDD:223796 36/109 (33%)
RRM_eIF4B 95..171 CDD:240848 26/79 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1530583at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1292
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.