DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4H1 and eif4h

DIOPT Version :9

Sequence 1:NP_001285330.1 Gene:eIF4H1 / 49809 FlyBaseID:FBgn0262734 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001096677.1 Gene:eif4h / 100125209 XenbaseID:XB-GENE-970966 Length:252 Species:Xenopus tropicalis


Alignment Length:392 Identity:124/392 - (31%)
Similarity:154/392 - (39%) Gaps:173/392 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EHARSGFGGDRA------------SKQLPTEPPFIAFVGNLPQGLVQGDVIKIFQDFEVKYVRLV 60
            :.|.|.|||.|.            .|:|||||||.|:|||||..:||||:..||:|..::.||||
 Frog     9 DRAYSSFGGSRGPRRGESGPGSRKQKELPTEPPFTAYVGNLPFHVVQGDIDNIFKDLSIRSVRLV 73

  Fly    61 KDRETDQFKGFCYVEFETLDNLERALECDGRIKLDDLSAPLRIDIADRRKNDRPGGGVGGGNGGM 125
            :|:|||:|||||||||:.||:|:.||..||.|.:|   ..:|:|||:.||.|:         ||.
 Frog    74 RDKETDKFKGFCYVEFDDLDSLKEALTYDGAIFID---RAIRVDIAEGRKQDK---------GGF 126

  Fly   126 TRGDGGRDGFQKRGPPRQGGSSQSYSRGGP----GTGG------GGREGGGGSGNRGDSRGSYID 180
                    ||:|.||..:|..|...||||.    .:|.      |||..||.||..||.||.   
 Frog   127 --------GFKKGGPDERGHDSSYGSRGGARDDFNSGYKDDDFLGGRGRGGRSGPPGDRRGP--- 180

  Fly   181 SYGGHNDRSRGVGGSGAGSGGGMNRGYNDRPANRGRYGSFNNDDRPFERNQDRDRGQREGSYGNQ 245
                            ..:|||..| |.|.|                          |.||    
 Frog   181 ----------------PPAGGGPGR-YRDAP--------------------------RGGS---- 198

  Fly   246 SRDGDRYNNFNRHRDRERTHYNPNQQSERPSGGMTGLGGGSGGSGGLGVGGGSSMGAIDNFRHFK 310
                   .:|....|.||.                                              
 Frog   199 -------ADFREPTDEERA---------------------------------------------- 210

  Fly   311 KPISRIISNMCQSRVSQLAVPRTNDNERPRLQLKPRTIAAPINAVAETKQSASIFGNAKPREEKL 375
                                      :||||||||||:|.|:|.||  ...::|||.||||||..
 Frog   211 --------------------------QRPRLQLKPRTVATPLNQVA--NPHSAIFGGAKPREESG 247

  Fly   376 KE 377
            |:
 Frog   248 KK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4H1NP_001285330.1 RRM <19..>139 CDD:223796 59/131 (45%)
RRM_eIF4H 28..106 CDD:240847 43/77 (56%)
eif4hNP_001096677.1 RRM_eIF4H 41..116 CDD:240847 43/77 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I7818
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1530583at2759
OrthoFinder 1 1.000 - - FOG0006177
OrthoInspector 1 1.000 - - otm48882
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1292
SonicParanoid 1 1.000 - - X4457
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.040

Return to query results.
Submit another query.