DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpinb9g

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_035585.2 Gene:Serpinb9g / 93806 MGIID:1919260 Length:377 Species:Mus musculus


Alignment Length:371 Identity:127/371 - (34%)
Similarity:206/371 - (55%) Gaps:27/371 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGL-PSEDKEAVAARYGALLND 84
            :.::|.:.:.::|:..||:||.:.|:||.:||:|.||.::..||.| |.||   |...:..||::
Mouse    15 LLKVLCQDNPSKNVCYSPMSISSALAMVLLGAKGDTAVQICQALHLNPDED---VHQGFQLLLHN 76

  Fly    85 LQGQ-EEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAE----RINQWVL 144
            |..| .:...|.:|||::|.:...|...:..:..:.:.||.|.:|...   |||    .||.||.
Mouse    77 LNKQNNQKYCLTMANRLFVENTCELLPTFKESCLKFYHSEMEQLSFAE---AAEESRQHINMWVS 138

  Fly   145 DQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMG 209
            .||:|||..::...|:.|..:.:|.||:||.|.|..:|:..:|:...|::...::.|||||.:..
Mouse   139 KQTNGKIPDLLSKDSVNSQTRLILANALYFHGTWCKRFEKNRTKEMPFKINKKETRPVQMMWRED 203

  Fly   210 TFRANYFRDLDAQVIELPYLNSNLSMTIFLPREVEGLSALE-----EKIVGFARP--LVAKEVYL 267
            |....|.:::.|||:.:||...:|:..:.||.|...:|.:|     ||:..:.:|  :...|.::
Mouse   204 TLFHAYVKEIQAQVLVMPYEGIDLNFVVLLPDEGVDISKVENNLTFEKLTAWTKPEFMNRTEFHV 268

  Fly   268 KLPKFKIEFRDELKETLEKLGIRELFT-DKSDLSGLFADKSGGKVSQVSHKAFLEVNEEGAEAAG 331
            .||||:::...::...|:.|||..:|. .|:||||: :.|....:|:.:||..:||||||.|||.
Mouse   269 YLPKFQLQEDYDMNSLLQHLGILNVFDGSKADLSGM-STKENLCLSEFAHKCVVEVNEEGTEAAA 332

  Fly   332 ATSVA---VTNRAGFSTFLMADHPFAFVI--RDANTIYFQGRVVSP 372
            |::|.   :.:.....|| .|||||.|.|  |..|:|.|.||..||
Mouse   333 ASAVKFIFLCSGPDPETF-CADHPFLFFIMHRTTNSILFCGRFSSP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 124/366 (34%)
Serpinb9gNP_035585.2 SERPIN 4..377 CDD:294093 125/369 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44262
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.