DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and SERPINB11

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001357404.1 Gene:SERPINB11 / 89778 HGNCID:14221 Length:392 Species:Homo sapiens


Alignment Length:389 Identity:133/389 - (34%)
Similarity:214/389 - (55%) Gaps:46/389 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSAL-----------GLPSEDKEA 73
            ::::.|:.::...|:..|.:|:...||||.:||.|.|.::|:..|           |.....|.:
Human    14 DVFKELNSNNIGDNIFFSSLSLLYALSMVLLGARGETEEQLEKVLHFSHTVDSLKPGFKDSPKCS 78

  Fly    74 VAAR----YGALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPV 134
            .|.|    :|...:.:...:....|.:|||:|.....:.:|.|.....:.:::..:::.......
Human    79 QAGRIHSEFGVEFSQINQPDSNCTLSIANRLYGTKTMAFHQQYLSCSEKWYQARLQTVDFEQSTE 143

  Fly   135 AAER-INQWVLDQTSGKI-----KGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQ 193
            ...: ||.||.::|:||:     |..|||.|:     .:|||||||||||::||...:|..|.||
Human   144 ETRKTINAWVENKTNGKVANLFGKSTIDPSSV-----MVLVNAIYFKGQWQNKFQVRETVKSPFQ 203

  Fly   194 VTANKSVPVQMMAQMGTFRANYFRDLDAQVIELPYLNSNLSMTIFLPREVEGLSALEEKIVG--- 255
            ::..|:|.|:||.|:|||:..:.::...||:||||:|:.|||.|.||..:..|..:|:::..   
Human   204 LSEGKNVTVEMMYQIGTFKLAFVKEPQMQVLELPYVNNKLSMIILLPVGIANLKQIEKQLNSGTF 268

  Fly   256 ----FARPLVAKEVYLKLPKFKIEFRDELKETLEKLGIRELFTD-KSDLSGLFADKSGGKVSQVS 315
                .:..::.:||.:.||:||:|.:.||...|:.||:.:||.. |:||||:...| |..:|:..
Human   269 HEWTSSSNMMEREVEVHLPRFKLETKYELNSLLKSLGVTDLFNQVKADLSGMSPTK-GLYLSKAI 332

  Fly   316 HKAFLEVNEEGAEAAGAT--SVAVTN---RAGFSTFLMADHPFAFVIR--DANTIYFQGRVVSP 372
            ||::|:|:|||.|||.||  |:||.:   ||.|.    |:|||.|.||  ..|||.|.|::.||
Human   333 HKSYLDVSEEGTEAAAATGDSIAVKSLPMRAQFK----ANHPFLFFIRHTHTNTILFCGKLASP 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 131/384 (34%)
SERPINB11NP_001357404.1 ovalbumin_like 4..392 CDD:239014 131/387 (34%)
RCL. /evidence=ECO:0000250 341..365 13/23 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.