DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and SERPINB12

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_005266835.2 Gene:SERPINB12 / 89777 HGNCID:14220 Length:437 Species:Homo sapiens


Alignment Length:413 Identity:120/413 - (29%)
Similarity:199/413 - (48%) Gaps:61/413 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGL----PSEDKE-------- 72
            :::|.:.|...::|:..||:|:...|.||.:||...:|.::...|..    .:|.||        
Human    26 DLFQEIGKDDRHKNIFFSPLSLSAALGMVRLGARSDSAHQIDEVLHFNEFSQNESKEPDPCLKSN 90

  Fly    73 --------------------------------AVAARYGALLNDLQGQEEGPILKLANRIYVNDQ 105
                                            .|:..:|.||:.|...:....|.:|||:|...:
Human    91 KQKVLADSSLEGQKKTTEPLDQQAGSLNNESGLVSCYFGQLLSKLDRIKTDYTLSIANRLYGEQE 155

  Fly   106 YSLNQNYNLAVREPFKSEAESISLTNGP-VAAERINQWVLDQTSGKIKGMIDPGSMTSDVKALLV 169
            :.:.|.|...|.:.:.:..||:.....| .:.:.||.||..|:.||||.:....::.::...:||
Human   156 FPICQEYLDGVIQFYHTTIESVDFQKNPEKSRQEINFWVECQSQGKIKELFSKDAINAETVLVLV 220

  Fly   170 NAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMGTFRANYFRDLDAQVIELPYLNSNLS 234
            ||:|||.:||:.||...|..:.|.:.||::..|:||.|.|.:|..:..::.||::|:.|....||
Human   221 NAVYFKAKWETYFDHENTVDAPFCLNANENKSVKMMTQKGLYRIGFIEEVKAQILEMRYTKGKLS 285

  Fly   235 MTIFLPR----EVEGLSALEEKIV-------GFARPLVAKEVYLKLPKFKIEFRDELKETLEKLG 288
            |.:.||.    .::||..||.||.       ..:..:..:.|.|..|:|.:|...:|...|:.:|
Human   286 MFVLLPSHSKDNLKGLEELERKITYEKMVAWSSSENMSEESVVLSFPRFTLEDSYDLNSILQDMG 350

  Fly   289 IRELFTD-KSDLSGLFADKSGGKVSQVSHKAFLEVNEEGAEAAGATSVAVTNRAGFS-TFLMADH 351
            |.::|.: ::||:|: :......:|::.||.|:||:|.|.:||.||...|:.|:..| ....|:|
Human   351 ITDIFDETRADLTGI-SPSPNLYLSKIIHKTFVEVDENGTQAAAATGAVVSERSLRSWVEFNANH 414

  Fly   352 PFAFVIR--DANTIYFQGRVVSP 372
            ||.|.||  ...||.|.|||.||
Human   415 PFLFFIRHNKTQTILFYGRVCSP 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 116/408 (28%)
SERPINB12XP_005266835.2 ovalbumin_like 16..437 CDD:239014 118/411 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 221 1.000 Domainoid score I2614
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 222 1.000 Inparanoid score I3541
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.