DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and SERPINB7

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001035237.1 Gene:SERPINB7 / 8710 HGNCID:13902 Length:380 Species:Homo sapiens


Alignment Length:387 Identity:119/387 - (30%)
Similarity:199/387 - (51%) Gaps:31/387 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VTSVACQTSKEIYQLLSKSHTNQ---NLVVSPVSIETILSMVFMGAEGSTAKELQ--------SA 63
            :.|:|...::..:.|..:...||   |:..|.:|:...|::|.:||:..:..::.        |.
Human     1 MASLAAANAEFCFNLFREMDDNQGNGNVFFSSLSLFAALALVRLGAQDDSLSQIDKLLHVNTASG 65

  Fly    64 LGLPSEDKEAVAARYGALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESIS 128
            .|..|..:..:.::...:.:|:....:...|.:.|.::....|..:::|.....:.:.::.|.:.
Human    66 YGNSSNSQSGLQSQLKRVFSDINASHKDYDLSIVNGLFAEKVYGFHKDYIECAEKLYDAKVERVD 130

  Fly   129 LTNGPVAAER-INQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTF 192
            .||......| ||:||.::|.||||.:|..|.::|....:||||:||||:|:|.|..::|....|
Human   131 FTNHLEDTRRNINKWVENETHGKIKNVIGEGGISSSAVMVLVNAVYFKGKWQSAFTKSETINCHF 195

  Fly   193 QVTANKSVPVQMMAQMGTFRANYFRDLDAQVIELPYLNSNLSMTIFLPREVEGLSALEEKIVGF- 256
            :........|.||.|...|..:...|...:::||.| |..::|.:.||.  ..||.:|.|:. | 
Human   196 KSPKCSGKAVAMMHQERKFNLSVIEDPSMKILELRY-NGGINMYVLLPE--NDLSEIENKLT-FQ 256

  Fly   257 -------ARPLVAKEVYLKLPKFKIEFRDELKETLEKLGIRELFTD-KSDLSGLFADKSGGK--V 311
                   .|.:.:|.|.:..|:||||...|:|:.|..||::::|.: |:||||:   .|||:  :
Human   257 NLMEWTNPRRMTSKYVEVFFPQFKIEKNYEMKQYLRALGLKDIFDESKADLSGI---ASGGRLYI 318

  Fly   312 SQVSHKAFLEVNEEGAEAAGAT-SVAVTNRAGFSTFLMADHPFAFVIRDANTIYFQGRVVSP 372
            |::.||:::||.|||.||..|| |..|..:...||...|||||.||||..:.|.|.|:|..|
Human   319 SRMMHKSYIEVTEEGTEATAATGSNIVEKQLPQSTLFRADHPFLFVIRKDDIILFSGKVSCP 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 115/376 (31%)
SERPINB7NP_001035237.1 serpinB7_megsin 1..380 CDD:381032 118/385 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 221 1.000 Domainoid score I2614
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 222 1.000 Inparanoid score I3541
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.980

Return to query results.
Submit another query.