DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and SERPINA6

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001747.3 Gene:SERPINA6 / 866 HGNCID:1540 Length:405 Species:Homo sapiens


Alignment Length:409 Identity:109/409 - (26%)
Similarity:193/409 - (47%) Gaps:45/409 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYYLCIFLWVT-----SVACQTSKEIYQLLSKSH----------------------TNQNLVVSP 38
            :.|.|: ||:.     :|........|..:|..|                      ..:|:.:||
Human     4 LLYTCL-LWLPTSGLWTVQAMDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISP 67

  Fly    39 VSIETILSMVFMGAEGSTAKELQSALGLPSEDKEAVAARYG-ALLNDLQGQEEGPI-LKLANRIY 101
            |||...|:|:.:|..|.|..:|...||....::.......| ..|:.|..:.:..: :.:.|.::
Human    68 VSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSDTSLEMTMGNALF 132

  Fly   102 VNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAERINQWVLDQTSGKIKGMIDPGSMTSDVKA 166
            ::....|.::::..::..::||..:::..:...|:.:||.:|.::|.|||..:.  ..:.|....
Human   133 LDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQGKIVDLF--SGLDSPAIL 195

  Fly   167 LLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMGTFRANYFRDLDAQVIELPYLNS 231
            :|||.|:|||.|...||.|.||...|.|.....|.|.||.|..|....:..:|..|::::.|:.:
Human   196 VLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTISYLHDSELPCQLVQMNYVGN 260

  Fly   232 NLSMTIFLPREVEG-----LSALEEKIVG-FARPLVAKEVYLKLPKFKIEFRDELKETLEKLGIR 290
            .   |:|.....:|     ::||....:. ::..|.:.:|.|.:||..|....:|.:.||::||.
Human   261 G---TVFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIA 322

  Fly   291 ELFTDKSDLSGLFADKSGGKVSQVSHKAFLEVNEEGAEAAGATSVAVTNRAGFSTFLMADHPFAF 355
            :|||::::.|.:..| :..|.|:|.|||.|::||||.:.||:|.|.: |.......|..:.||..
Human   323 DLFTNQANFSRITQD-AQLKSSKVVHKAVLQLNEEGVDTAGSTGVTL-NLTSKPIILRFNQPFII 385

  Fly   356 VIRDANT--IYFQGRVVSP 372
            :|.|..|  ..|..||::|
Human   386 MIFDHFTWSSLFLARVMNP 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 101/384 (26%)
SERPINA6NP_001747.3 alpha-1-antitrypsin_like 42..401 CDD:239011 98/365 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.