DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and SRP3

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_176586.1 Gene:SRP3 / 842706 AraportID:AT1G64030 Length:385 Species:Arabidopsis thaliana


Alignment Length:386 Identity:112/386 - (29%)
Similarity:179/386 - (46%) Gaps:72/386 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLSKSHTNQNLVVSPVSIETILSMVFMGAEGS-TAKELQSALGLPSEDK-EAVAARYGALLNDLQ 86
            :||.:..:.|::.||.||.:.::|...|..|. .:.::.|.|...|.|: :.|.....:::...:
plant    21 VLSSAPKDSNVIFSPASINSAITMHAAGPGGDLVSGQILSFLRSSSIDELKTVFRELASVVYADR 85

  Fly    87 GQEEGPILKLANRIYVNDQY-------SLNQNYNLAVREP--FKSEAESISLTNGPVAAERINQW 142
            ....||.:..||.::::...       .|.:|:..||..|  |:||||.:        .:.:|.|
plant    86 SATGGPKITAANGLWIDKSLPTDPKFKDLFENFFKAVYVPVDFRSEAEEV--------RKEVNSW 142

  Fly   143 VLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQ 207
            |...|:..||.::..||:||....:..||:.|||.|:..|:...||.:.|.:....||.|..|: 
plant   143 VEHHTNNLIKDLLPDGSVTSLTNKIYANALSFKGAWKRPFEKYYTRDNDFYLVNGTSVSVPFMS- 206

  Fly   208 MGTFRANYFRDLDA-QVIELPY------LNSNLSMTIFLPREVEGLSALEEKIV---GFAR---P 259
              ::...|.|..|. :|:.|||      .|...||..:||.:.:||..|.||:.   ||..   |
plant   207 --SYENQYVRAYDGFKVLRLPYQRGSDDTNRKFSMYFYLPDKKDGLDDLLEKMASTPGFLDSHIP 269

  Fly   260 LVAKEV-YLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQVSHKAFLEVN 323
            ....|: ..::|||||||...:...|::||:|.:                    .:.|||.:|::
plant   270 TYRDELEKFRIPKFKIEFGFSVTSVLDRLGLRSM--------------------SMYHKACVEID 314

  Fly   324 EEGAEAAGATS----------VAVTNRAGFSTFLMADHPFAFVIRD--ANTIYFQGRVVSP 372
            |||||||.||:          |....:..|    :|||||.|:||:  ..|:.|.|::..|
plant   315 EEGAEAAAATADGDCGCSLDFVEPPKKIDF----VADHPFLFLIREEKTGTVLFVGQIFDP 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 111/381 (29%)
SRP3NP_176586.1 serpinP_plants 8..371 CDD:381001 111/384 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H76659
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.