DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and AT1G62170

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001185292.1 Gene:AT1G62170 / 842513 AraportID:AT1G62170 Length:466 Species:Arabidopsis thaliana


Alignment Length:418 Identity:108/418 - (25%)
Similarity:175/418 - (41%) Gaps:104/418 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSAL-----GLPSEDKEAVAARYGALLN 83
            ::|....|.|.|.||.||...|:||...:.|...:||:|.:     ...:::..|:.....:::.
plant    82 VISSVAKNSNFVFSPASINAALTMVAASSGGEQGEELRSFILSFLKSSSTDELNAIFREIASVVL 146

  Fly    84 DLQGQEEGPILKLANRIYVNDQYSLN-------QNYNLA--VREPFKSEA-------------ES 126
            ....::.||.:.:.|.::::...|:|       :|:..|  .:..|:|:.             ||
plant   147 VDGSKKGGPKIAVVNGMWMDQSLSVNPLSKDLFKNFFSAAFAQVDFRSKCNVLNKLGLAVSLLES 211

  Fly   127 I------------SLTNGPVAAERINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWE 179
            |            .:.:.......:|.|....|:|.||.::..||:||....:..:|:||||.||
plant   212 IFHISTLFDFKFALIRSAEEVRTEVNAWASSHTNGLIKDLLPRGSVTSLTDRVYGSALYFKGTWE 276

  Fly   180 SKFDPAKTRASTFQVTANKSVPVQMMAQMGTFRANYFRDLDA-QVIELPY------LNSNLSMTI 237
            .|:..:.|:...|.:....||.|..|:   :|...|....|. :|:.|||      .|.|.:|.|
plant   277 EKYSKSMTKCKPFYLLNGTSVSVPFMS---SFEKQYIAAYDGFKVLRLPYRQGRDNTNRNFAMYI 338

  Fly   238 FLPREVEGLSALEEKIV---GF-------ARPLVAKEVYLKLPKFKIEFRDELKETLEKLGIREL 292
            :||.:...|..|.|::.   ||       .|..|.|   .::|||||||..|....         
plant   339 YLPDKKGELDDLLERMTSTPGFLDSHNPERRVKVGK---FRIPKFKIEFGFEASSA--------- 391

  Fly   293 FTD-KSDLSGLFADKSGGKVSQVSHKAFLEVNEEGAEAAGATSVAVTNRAGFSTFL--------- 347
            |:| :.|:|             ...|..:|::|:|.|       |||..|..|.:|         
plant   392 FSDFELDVS-------------FYQKTLIEIDEKGTE-------AVTFTAFRSAYLGCALVKPID 436

  Fly   348 -MADHPFAFVIRD--ANTIYFQGRVVSP 372
             :|||||.|:||:  ..|:.|.|::..|
plant   437 FVADHPFLFLIREEQTGTVLFAGQIFDP 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 107/413 (26%)
AT1G62170NP_001185292.1 SERPIN 69..464 CDD:294093 107/416 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H76659
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.