DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and AT2G26390

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_180207.1 Gene:AT2G26390 / 817179 AraportID:AT2G26390 Length:389 Species:Arabidopsis thaliana


Alignment Length:393 Identity:122/393 - (31%)
Similarity:191/393 - (48%) Gaps:50/393 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVACQTSKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDK-EAVA 75
            :|..:.:|::.:  :......|:|.||:||..:||::..|:...|.:|:.|.|..||.|. .||.
plant    12 NVVARLAKKVIE--TDVANGSNVVFSPMSINVLLSLIAAGSNPVTKEEILSFLMSPSTDHLNAVL 74

  Fly    76 ARY---GALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPV-AA 136
            |:.   |...:||       .|..|:.::::....|..::...:...:|:....:.....|| ..
plant    75 AKIADGGTERSDL-------CLSTAHGVWIDKSSYLKPSFKELLENSYKASCSQVDFATKPVEVI 132

  Fly   137 ERINQWVLDQTSGKIKGMIDPGSMTSDVK------ALLVNAIYFKGQWESKFDPAKTRASTFQVT 195
            :.:|.|....|:|.||.::. ...|..:|      .:|.||:|||..|..|||...|:.:.|.:.
plant   133 DEVNIWADVHTNGLIKQILS-RDCTDTIKEIRNSTLILANAVYFKAAWSRKFDAKLTKDNDFHLL 196

  Fly   196 ANKSVPVQMMAQMGTFRANYFRDLDA-QVIELPYLNS--NLSMTIFLPREVEGLSALEEKI---V 254
            ...:|.|..|.   :::..|.|..|. ||:.|||:..  :.||.|:||.:.:||:||.|||   .
plant   197 DGNTVKVPFMM---SYKDQYLRGYDGFQVLRLPYVEDKRHFSMYIYLPNDKDGLAALLEKISTEP 258

  Fly   255 GFAR---PLVAKEV-YLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGG---KVS 312
            ||..   ||....| .|::||....|..:..|.|:.:|:...||.|.:|:.:....|.|   .||
plant   259 GFLDSHIPLHRTPVDALRIPKLNFSFEFKASEVLKDMGLTSPFTSKGNLTEMVDSPSNGDKLHVS 323

  Fly   313 QVSHKAFLEVNEEGAEAAGATSVAV------TNRAGFSTFLMADHPFAFVIRDANT--IYFQGRV 369
            .:.|||.:||:|||.||| |.|||:      .....|    :|||||.|.:|:.|:  |.|.|:|
plant   324 SIIHKACIEVDEEGTEAA-AVSVAIMMPQCLMRNPDF----VADHPFLFTVREDNSGVILFIGQV 383

  Fly   370 VSP 372
            :.|
plant   384 LDP 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 119/384 (31%)
AT2G26390NP_180207.1 serpinP_plants 8..386 CDD:381001 121/391 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H76659
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.