DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpina3a

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001161177.1 Gene:Serpina3a / 74069 MGIID:1921319 Length:422 Species:Mus musculus


Alignment Length:383 Identity:109/383 - (28%)
Similarity:185/383 - (48%) Gaps:32/383 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VTSVACQTSKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLP-SEDKEA 73
            :.|:....:..:|:.|:..:.::|:|.||:||...|:::.:||:.:|.:|:...|... :|..||
Mouse    49 LASINTDFAFSLYKKLALKNPHKNIVFSPLSISAALALMSLGAKDNTLEEILEGLKFNLTETPEA 113

  Fly    74 -VAARYGALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAE 137
             :...:|.||..|...|....:...|.::::....:...:....|..:|:||.:........|.:
Mouse   114 DIHQNFGHLLQMLIQPENQVQINAGNALFIDKHLQILTEFKEKARALYKAEAFTADFQLPREATK 178

  Fly   138 RINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPV 202
            .||.:|..||.||||.::  ..:..:....|||.:.|:|.|...|||..|....|.:...::|.|
Mouse   179 LINDYVRKQTQGKIKELV--SDLHRNTSMALVNFLNFQGFWNVTFDPEDTFLGNFTLDRKRTVNV 241

  Fly   203 QMMAQMGTFRANYFRDLDAQ--VIELPYLNSNLSMTIFLPREVEGLSALEEKIVGFA-------- 257
            .|| :......|||||.:.|  |:||.|: .|.|....||.:.. :..:|:.:...:        
Mouse   242 PMM-KTEELTTNYFRDEEMQSTVMELNYI-GNASFLFILPDQGR-IQHVEDSLQPQSLRKWRKSL 303

  Fly   258 RPLVAKEVYLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQVSHKAFLEV 322
            ||.:..|  |.||||.:.....|.:.|.:|||:|:|:.::||||:...|: .:|||:.|:|.|:|
Mouse   304 RPRMLDE--LSLPKFSLSQDYNLNDILPELGIKEVFSTQADLSGITGAKN-IRVSQMIHQAALDV 365

  Fly   323 NEEGAEAAGATSVAVTNRAGFST------FLMADHPFAFVIRDA--NTIYFQGRVVSP 372
            .|...||    .|....|..|.:      .:..|..|.::|.|.  .:|...|:|::|
Mouse   366 TETHTEA----DVITIARYNFQSAKIKAKIVKVDREFLYLILDPMFKSISVMGKVINP 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 106/372 (28%)
Serpina3aNP_001161177.1 SERPIN 53..416 CDD:294093 106/374 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.