DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpina9

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001348839.1 Gene:Serpina9 / 71907 MGIID:1919157 Length:418 Species:Mus musculus


Alignment Length:371 Identity:109/371 - (29%)
Similarity:189/371 - (50%) Gaps:31/371 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGL----PSEDKEAVAARYGAL 81
            :||.|::.:..||::.|||||.|.|:|:.:||..:|..::...||.    .||....:...|  |
Mouse    57 LYQRLAQENPGQNILFSPVSISTSLAMLSLGARSATKTQILRTLGFNFTWVSEPTIHMGFEY--L 119

  Fly    82 LNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAERINQWVLDQ 146
            :..|....:|..|::.:.:::..:..|...:...|::.:.::..|...:|...|..:||.:|..:
Mouse   120 VRSLNKCHQGRELRMGSVLFIRKELQLQATFLDRVKKLYGAKVFSEDFSNAATAQAQINSYVEKE 184

  Fly   147 TSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRAS-TFQVTANKSVPVQMMAQMGT 210
            |.||:..:|.  .:.|....:|||.|:||..|...|..|.|..| .|.::...:|.|.||.|..:
Mouse   185 TKGKVVDVIQ--DLDSQTAMVLVNHIFFKANWTQPFSTANTNKSFPFLLSKGTTVHVPMMHQTES 247

  Fly   211 FRANYFRDLDAQVIELPYLNSNLSMTIFLP-----REVE-GLSALEEKIVGFARPLVAKEVYLKL 269
            |.....::|...::::.|....::..: ||     |::| .|||  .::..::|.|..:.:.:.:
Mouse   248 FAFGVDKELGCSILQMDYRGDAVAFFV-LPGKGKMRQLEKSLSA--RRLRKWSRSLQKRWIKVFI 309

  Fly   270 PKFKIEFRDELKETLEKLGIRELFTDKSDLSGL----FADKSGGKVSQVSHKAFLEVNEEGAEAA 330
            |||.|.....|:..|.|:|||:.|...:|.||:    |.     :||:.:|||.|:|:|||.|||
Mouse   310 PKFSISASYNLETILPKMGIRDAFNSNADFSGITKTHFL-----QVSKAAHKAVLDVSEEGTEAA 369

  Fly   331 GATS--VAVTNRAGFSTFLMADHPFAFVIRDANT--IYFQGRVVSP 372
            .||:  :.|.:|...|:.:....||..::.|.||  :.|.|:|.:|
Mouse   370 AATTTKLIVRSRDTPSSIIAFKEPFLILLLDKNTESVLFLGKVENP 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 107/366 (29%)
Serpina9NP_001348839.1 alpha-1-antitrypsin_like 49..412 CDD:239011 107/366 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.